CN185528

Overview
NameCN185528
Unique NameCN185528
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9471 contig Csv1_Contig9471:189..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TSAP1_BOVIN (tRNA selenocysteine 1-associated protein 1 OS=Bos taurus GN=TRNAU1AP PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.950e-35
Identity = 80/171 (46.78%), Postives = 113/171 (66.08%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFV-SGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE--QNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVL-CSTRPMRI 622
            SLW+GDL+P+M+E++I+  F   GE V S K+IRN+ T    GY F+EF   A AE+ L   NG  +P     + F+LN+ATYG   ++ D+ P++++FVGDL  DV D +L E F  VY S +G KVV D+ TG SKGYGFV+F DE EQ R++TE  G +   ++P+R+
Sbjct:    4 SLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYG---KQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAIGLGSKPVRL 170          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TSAP1_HUMAN (tRNA selenocysteine 1-associated protein 1 OS=Homo sapiens GN=TRNAU1AP PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.159e-35
Identity = 80/171 (46.78%), Postives = 113/171 (66.08%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFV-SGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE--QNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVL-CSTRPMRI 622
            SLW+GDL+P+M+E++I+  F   GE V S K+IRN+ T    GY F+EF   A AE+ L   NG  +P     + F+LN+ATYG   ++ D+ P++++FVGDL  DV D +L E F  VY S +G KVV D+ TG SKGYGFV+F DE EQ R++TE  G +   ++P+R+
Sbjct:    4 SLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYG---KQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRL 170          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TSAP1_RAT (tRNA selenocysteine 1-associated protein 1 OS=Rattus norvegicus GN=Trnau1ap PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 8.801e-35
Identity = 80/171 (46.78%), Postives = 112/171 (65.50%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFV-SGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE--QNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVL-CSTRPMRI 622
            SLW+GDL+P+M+E++I+  F   GE V S K+IRN+ T    GY F+EF   A AE+ L   NG  +P     + F+LN+ATYG   ++ D+ P++++FVGDL  DV D +L E F  VY S +G KVV D+ TG SKGYGFV+F DE EQ R++TE  G +    +P+R+
Sbjct:    4 SLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYG---KQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAVGLGCKPVRL 170          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TSAP1_PONAB (tRNA selenocysteine 1-associated protein 1 OS=Pongo abelii GN=TRNAU1AP PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.501e-34
Identity = 79/171 (46.20%), Postives = 112/171 (65.50%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFV-SGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE--QNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVL-CSTRPMRI 622
            SLW+GDL+P+M+E++I+  F   GE V S K+IRN+ T    GY F+EF   A AE+ L   NG  +P     + F+LN+ TYG   ++ D+ P++++FVGDL  DV D +L E F  VY S +G KVV D+ TG SKGYGFV+F DE EQ R++TE  G +   ++P+R+
Sbjct:    4 SLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYVTYG---KQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRL 170          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TSAP1_MOUSE (tRNA selenocysteine 1-associated protein 1 OS=Mus musculus GN=Trnau1ap PE=1 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 1.501e-34
Identity = 80/171 (46.78%), Postives = 111/171 (64.91%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFV-SGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE--QNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVL-CSTRPMRI 622
            SLW+GDL+P+M+E++I+  F   GE V S K+IRN+ T    GY F+EF   A AE+ L   NG  +P     + F+LN+ATYG   ++ D+ P++++FVGDL  DV D +L E F  VY S +G KVV D  TG SKGYGFV+F DE EQ R++TE  G +    +P+R+
Sbjct:    4 SLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYG---KQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-PTGVSKGYGFVKFTDELEQKRALTECQGAVGLGCKPVRL 170          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: CSX1_SCHPO (RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe GN=csx1 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 9.730e-34
Identity = 73/171 (42.69%), Postives = 102/171 (59.65%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSE--GYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQ--DDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            +LW+GDL+PWM+ ++I  ++    E V+ KV+R+K ++      Y F++F S AAAER L  +N T +P     F+LNWAT G  +        P+F+IFVGDL     D  L  TFR++Y S   AK++ D  TG S+ YGFVRF  E EQ  ++  M G LC  RP+RI
Sbjct:   86 TLWMGDLEPWMDATFIQQLWASLNEPVNVKVMRSKASSSETLISYCFVQFSSSAAAERALMKYNNTMIPGAHCTFKLNWATGGGIQHNNFVSRDPEFSIFVGDLLPTTEDSDLFMTFRSIYPSCTSAKIIVDPVTGLSRKYGFVRFSSEKEQQHALMHMQGYLCQGRPLRI 256          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: YG41_SCHPO (Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe GN=SPBC23E6.01c PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 1.271e-33
Identity = 70/182 (38.46%), Postives = 112/182 (61.54%), Query Frame = 2
Query:   83 YGVAPDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGA-GERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            YG + D +     +LW+G+L+PW+ E++I  ++   G+ V  K+IRN+ T  + GY F+EF S   A   + + N   +P T   F+LNWA+ G   E+      +++IFVGDL+ +V ++ +   F + Y+S K AK++TD  T  S+GYGFVRF DE++Q  ++ EM G +C  RP+R+G
Sbjct:   81 YGSSRDENVYQKTTLWMGELEPWVTEAFIQQVWNTLGKAVKVKLIRNRYTGMNAGYCFVEFASPHEASSAM-SMNNKPIPGTNHLFKLNWASGGGLREKSISKASEYSIFVGDLSPNVNEFDVYSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDENDQKSALAEMQGQICGDRPIRVG 261          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TSP1L_DANRE (tRNA selenocysteine 1-associated protein 1-like OS=Danio rerio GN=trnau1apl PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.835e-32
Identity = 75/171 (43.86%), Postives = 109/171 (63.74%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSG-KVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE--QNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTE-MNGVLCSTRPMRI 622
            SLW+GDL P+M+E++I   F   GE   G K+I ++ T  S GY F+E    A+ +R +Q  NG  +P +   + F+LN+ATYG   +R + GP+F++FVGDL ++V DY L + F   + S KGAKVVTD   G S+GYGFV+F DE+EQ +++ E  N      +P+RI
Sbjct:    7 SLWMGDLDPYMDENFIKQAFSTMGETAFGVKIITHRVTGGSAGYCFVEMADEASVDRCVQRLNGKLVPGSNPPRKFKLNYATYG---KRPEPGPEFSVFVGDLTSEVDDYQLHQFFLKKFPSCKGAKVVTD-PYGNSRGYGFVKFSDENEQKKALEEFQNASGLGGKPIRI 173          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TSAP1_DANRE (tRNA selenocysteine 1-associated protein 1 OS=Danio rerio GN=trnau1ap PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.530e-23
Identity = 62/162 (38.27%), Postives = 92/162 (56.79%), Query Frame = 2
Query:  116 IRSLWIGDLQPWMEESYIASIFGHTGE-FVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMP--STEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            + SLW+G+L+P+M+E +I   F   GE  V  ++IR+K T  + GYGF+E     A ER L+  NG  +P  +  + F+L+ + YG    +Q +   F++FV DL  DV D +L E F   +SS    K+V D   G SK  GFV F  E EQ R++ ++ G
Sbjct:    1 MNSLWMGNLEPYMDEDFICRAFAQMGETVVKIRLIRDKITGKNAGYGFVELADDTAVERCLRKVNGKPLPGATPPKRFKLSRSNYG----KQGESSTFSLFVSDLTPDVDDGMLYEFFHYHFSSCCSGKIVLD-ANGHSKCCGFVSFESEREQKRALVDLQG 157          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: NAM8_YEAST (Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 3.039e-19
Identity = 62/184 (33.70%), Postives = 98/184 (53.26%), Query Frame = 2
Query:  125 LWIGDLQPWMEESYIASIFGHTGEF-VSGKVIRNKQTNF----------SEGYGFIEFVSHAAAERVLQTFNGTQMPS-TEQNFRLNWATYGAGERRQD-----DGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            L++GDL P  +++ +  I+   GE  ++ +++ N   N           ++GY F++F S   A   L   NG  +P+   +  +LNWAT               G + +IFVGDLA +VT+  L E F   Y+S   AK+V D+ TG SKGYGFV+F +  EQ  +++EM GV  + R +++G
Sbjct:   56 LYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPSSTHAANALLK-NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVG 238          
The following BLAST results are available for this feature:
BLAST of CN185528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
TSAP1_BOVIN3.950e-3546.78tRNA selenocysteine 1-associated protein 1 OS=Bos ... [more]
TSAP1_HUMAN5.159e-3546.78tRNA selenocysteine 1-associated protein 1 OS=Homo... [more]
TSAP1_RAT8.801e-3546.78tRNA selenocysteine 1-associated protein 1 OS=Ratt... [more]
TSAP1_PONAB1.501e-3446.20tRNA selenocysteine 1-associated protein 1 OS=Pong... [more]
TSAP1_MOUSE1.501e-3446.78tRNA selenocysteine 1-associated protein 1 OS=Mus ... [more]
CSX1_SCHPO9.730e-3442.69RNA-binding post-transcriptional regulator csx1 OS... [more]
YG41_SCHPO1.271e-3338.46Uncharacterized RNA-binding protein C23E6.01c OS=S... [more]
TSP1L_DANRE1.835e-3243.86tRNA selenocysteine 1-associated protein 1-like OS... [more]
TSAP1_DANRE4.530e-2338.27tRNA selenocysteine 1-associated protein 1 OS=Dani... [more]
NAM8_YEAST3.039e-1933.70Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185528 ID=CN185528|Name=CN185528|organism=Citrus sinensis|type=EST|length=625bp
GCAACAACATCAAACTCCGGTGCCACCTCCGGTTGGATGGACTCCGCAGC
CGGTGCCTCCTCCATCTCAGCAGACGCAGCCCTACGGTGTCGCCCCCGAT
GCTTCCTCCGACGGGATCCGTTCTTTGTGGATCGGAGACTTGCAGCCGTG
GATGGAGGAGAGTTATATCGCCAGCATCTTCGGCCATACTGGAGAGTTTG
TTTCAGGAAAGGTTATTCGCAACAAGCAAACAAATTTTTCAGAGGGTTAT
GGTTTTATTGAGTTTGTTAGTCATGCTGCTGCAGAGAGGGTTTTGCAGAC
TTTTAATGGCACCCAAATGCCAAGCACTGAGCAAAACTTCAGACTGAATT
GGGCAACCTATGGGGCTGGTGAGAGGCGTCAAGATGATGGTCCTGATTTT
ACAATTTTTGTGGGAGATTTGGCTGCCGATGTAACTGACTATGTGCTACA
AGAAACATTTAGAGCTGTCTACTCGTCAGTGAAGGGTGCTAAAGTGGTCA
CTGATAGAACCACTGGACGCTCTAAGGGGTATGGTTTTGTGAGATTTGGG
GATGAAAGTGAACAATTGCGTTCCATGACCGAAATGAATGGCGTGCTCTG
CTCTACTAGACCTATGCGGATTGGG
back to top