CN185523

Overview
NameCN185523
Unique NameCN185523
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length768
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1618 contig Csv1_Contig1618:155..920. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185523 vs. ExPASy Swiss-Prot
Match: REMO_SOLTU (Remorin OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.553e-47
Identity = 106/182 (58.24%), Postives = 125/182 (68.68%), Query Frame = -3
Query:  197 SPTTTVAEEKAVTQ------LHDQEKPVDDSKALAVVD-QTPDXXXXXXXXXXXXXXSHDRDVALAEVEKEKRESFIKAWEESEKTKAENKAQKKLSAVAAWENXXXXXXXXXXXXXEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPKKLLGCF 721
            +P   VA+EKA+          ++EKP DDSKAL VV+ + P+                DRD  LA V  EKR S IKAWEESEK+KAENKAQKK+SA+ AWEN             EEQLE+KKAEY EKMKNK+AL+HKEAEEKRAM+EA+RGED+LKAEE+AAKYRATGT PKK+LG F
Sbjct:   24 APKEVVADEKAIVAPALPPPAEEKEKP-DDSKALVVVETKAPEPADEKKEGSI------DRDAVLARVATEKRVSLIKAWEESEKSKAENKAQKKVSAIGAWENSKKANLEAELKKMEEQLEKKKAEYTEKMKNKIALLHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGTAPKKILGIF 198          
BLAST of CN185523 vs. ExPASy Swiss-Prot
Match: Y3126_ARATH (Uncharacterized protein At3g61260 OS=Arabidopsis thaliana GN=At3g61260 PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.975e-44
Identity = 100/173 (57.80%), Postives = 118/173 (68.21%), Query Frame = -3
Query:  197 TTTVAEEKAVTQLHDQEKPVDDSKALAVVDQTPDXXXXXXXXXXXXXXSHDRDVALAEVEKEKRESFIKAWEESEKTKAENKAQKKLSAVAAWENXXXXXXXXXXXXXEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPKKLLGCF 715
            T  VAEEK   Q    E+  DDSKAL VV++  +                DRDV LA++ KEKR SF++AWEESEK+KAENKA+KK++ V AWEN             EEQLE+KKAEYAE+MKNKVA +HKEAEE+RAM+EA+RGEDVLKAEE AAKYRATG  PK   GCF
Sbjct:   46 TKDVAEEKI--QNPPPEQIFDDSKALTVVEKPVEEPAPAKPASASL----DRDVKLADLSKEKRLSFVRAWEESEKSKAENKAEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEETAAKYRATGIVPKATCGCF 212          
BLAST of CN185523 vs. ExPASy Swiss-Prot
Match: REMO_ARATH (Remorin OS=Arabidopsis thaliana GN=DBP PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 5.373e-41
Identity = 95/170 (55.88%), Postives = 117/170 (68.82%), Query Frame = -3
Query:  197 VAEEKAVTQLHDQEKPVDDSKALAVVDQTPDXXXXXXXXXXXXXXSHDRDVALAEVEKEKRESFIKAWEESEKTKAENKAQKKLSAVAAWENXXXXXXXXXXXXXEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPKKLLGCF 706
            VA+EK    +H+   P  +SKALAVV++  +                DRDV LA++EKEK+ SFIKAWEESEK+KAEN+AQKK+S V AWEN             EE+LE+KKA+Y EKMKNKVA +HK AEEKRAMVEA++GE++LKAEE+ AKYRATG  PK   GCF
Sbjct:   31 VADEK----IHNP--PPVESKALAVVEKPIEEHTPKKASSGSA----DRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENSKKAAVEAQLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLKAEEMGAKYRATGVVPKATCGCF 190          
The following BLAST results are available for this feature:
BLAST of CN185523 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
REMO_SOLTU6.553e-4758.24Remorin OS=Solanum tuberosum PE=1 SV=1[more]
Y3126_ARATH3.975e-4457.80Uncharacterized protein At3g61260 OS=Arabidopsis t... [more]
REMO_ARATH5.373e-4155.88Remorin OS=Arabidopsis thaliana GN=DBP PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H16_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185523 ID=CN185523|Name=CN185523|organism=Citrus sinensis|type=EST|length=768bp
CCCCTTTTTTTTTTTTTTAAAAAGACAGATAGTACTTCTATTCCACAACA
CTTCGATCTTATCATTTGCTTTAGTTCCATTGAGATTTACACACAAAACA
GCACACCAATGACACAAGAAAGTATACAGATATAAAGTTGGGAGTCATAA
TCATAAACACAAAAAATATACCACTTGCAAAAACAATTTGATTTCAGAAG
CAACCGAGGAGCTTCTTTGGAGTGGTCCCAGTAGCCCGATATTTTGCAGC
TATCTCCTCAGCCTTAAGAACGTCTTCTCCCCGTCTAGCTTCAACCATTG
CCCTTTTCTCTTCTGCTTCCTTGTGAACTAGAGCTACCTTATTTTTCATT
TTTTCAGCATACTCTGCCTTCTTCCTCTCCAGTTGTTCCTCAATCTTTTT
CAGTTTGGCTTCTAGAGATGCTTTCTTGCTATTTTCCCATGCAGCAACAG
CTGAGAGCTTTTTCTGAGCCTTATTCTCTGCTTTTGTTTTTTCACTCTCT
TCCCATGCCTTGATAAAAGACTCTCTCTTTTCCTTTTCGACCTCTGCAAG
AGCAACATCTCTATCATGCGATCCAGAAATTTTCTTTTCCCCAGAAATTT
TCTTTTTGGCCGAATCTGGAGTTTGATCAACTACTGCGAGAGCTTTGGAG
TCATCAACAGGCTTCTCTTGATCATGTAATTGAGTAACAGCTTTCTCCTC
CGCCACCGTCGTTGTTGGGGACAGCCCCGAGCCCCGAGCTGGAGCAAGAG
CTGGAGCTGGAGCTGGGG
back to top