CN185508

Overview
NameCN185508
Unique NameCN185508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length390
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2229 contig Csv1_Contig2229:27..415. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185508 vs. ExPASy Swiss-Prot
Match: VTI11_ARATH (Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana GN=VTI11 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 5.956e-28
Identity = 48/72 (66.67%), Postives = 62/72 (86.11%), Query Frame = 3
Query:   84 MSQVFEGYERQYCELSAGLSRKCTAASALDGELKKQKLSEIKTGLDDADALIRKMDLEARSSQPSVEGNASV 299
            MS VF+GYERQYCELSA LS+KC++A +LDGE KKQKLSEIK+GL++A+ LIRKMDLEAR+  P+++ +  V
Sbjct:    1 MSDVFDGYERQYCELSASLSKKCSSAISLDGEQKKQKLSEIKSGLENAEVLIRKMDLEARTLPPNLKSSLLV 72          

HSP 2 Score: 43.1282 bits (100), Expect = 5.956e-28
Identity = 22/37 (59.46%), Postives = 27/37 (72.97%), Query Frame = 1
Query:  280 LKAMLLSKLIEYKTDLNKLKNEVKRVTSCNVIQAARD 390
            LK+ LL KL E+K+DLN  K EVKR+TS  +  AARD
Sbjct:   66 LKSSLLVKLREFKSDLNNFKTEVKRITSGQLNAAARD 102          
BLAST of CN185508 vs. ExPASy Swiss-Prot
Match: VTI13_ARATH (Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.314e-27
Identity = 47/72 (65.28%), Postives = 61/72 (84.72%), Query Frame = 3
Query:   84 MSQVFEGYERQYCELSAGLSRKCTAASALDGELKKQKLSEIKTGLDDADALIRKMDLEARSSQPSVEGNASV 299
            MSQ FE YERQYCE+SA LS+KCT+A ALDGE KKQ LSEIK+G+++A+AL++KMDLEAR+  P+V+ +  V
Sbjct:    1 MSQGFERYERQYCEISANLSKKCTSAIALDGEQKKQNLSEIKSGVEEAEALVKKMDLEARNLPPNVKSSLLV 72          

HSP 2 Score: 44.2838 bits (103), Expect = 1.314e-27
Identity = 22/37 (59.46%), Postives = 27/37 (72.97%), Query Frame = 1
Query:  280 LKAMLLSKLIEYKTDLNKLKNEVKRVTSCNVIQAARD 390
            +K+ LL KL EYK+DLN  K EVKR+TS N+   ARD
Sbjct:   66 VKSSLLVKLREYKSDLNNFKTEVKRITSGNLNATARD 102          
BLAST of CN185508 vs. ExPASy Swiss-Prot
Match: VTI12_ARATH (Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana GN=VTI12 PE=1 SV=3)

HSP 1 Score: 97.0561 bits (240), Expect = 3.033e-20
Identity = 51/87 (58.62%), Postives = 64/87 (73.56%), Query Frame = 3
Query:   84 MSQVFEGYERQYCELSAGLSRKCTAASAL-DGELKKQKLSEIKTGLDDADALIRKMDLEARSSQPSVEGNASV*VNRIQNRFEQVEK 341
            MS VFEGYERQYCELS  LSRKC +AS L +GE KK K++EIK+G+D+AD LIRKMDLEARS QPS +      +   ++   Q++K
Sbjct:    1 MSDVFEGYERQYCELSTNLSRKCHSASVLSNGEEKKGKIAEIKSGIDEADVLIRKMDLEARSLQPSAKAVCLSKLREYKSDLNQLKK 87          
The following BLAST results are available for this feature:
BLAST of CN185508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
VTI11_ARATH5.956e-2866.67Vesicle transport v-SNARE 11 OS=Arabidopsis thalia... [more]
VTI13_ARATH1.314e-2765.28Vesicle transport v-SNARE 13 OS=Arabidopsis thalia... [more]
VTI12_ARATH3.033e-2058.62Vesicle transport v-SNARE 12 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H07_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185508 ID=CN185508|Name=CN185508|organism=Citrus sinensis|type=EST|length=390bp
GAGGCTGGATCTTCCGGTGCCTAATTTCCTTCTCACCGATCGTCTCCACG
ATCACTTCCCGTTAGTGAGGGATTCGGGCGAAGATGAGCCAGGTGTTTGA
AGGATACGAGCGCCAATACTGCGAGCTCTCTGCTGGATTATCGCGGAAGT
GCACAGCGGCAAGTGCTCTTGATGGAGAGCTGAAAAAGCAGAAACTTTCT
GAAATTAAAACTGGATTGGATGATGCTGATGCTCTGATTCGGAAAATGGA
CCTAGAGGCAAGAAGTTCGCAGCCGAGTGTTGAAGGCAATGCTTCTGTCT
AAGTTAATAGAATACAAAACCGATTTGAACAAGTTGAAAAATGAAGTGAA
AAGAGTCACATCATGTAATGTCATCCAGGCTGCCCGCGAT
back to top