CN185507

Overview
NameCN185507
Unique NameCN185507
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length423
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185507 vs. ExPASy Swiss-Prot
Match: VTI13_ARATH (Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.486e-27
Identity = 59/85 (69.41%), Postives = 69/85 (81.18%), Query Frame = -3
Query:  167 IKESRRTMLETEEFGVLFLQDLHYQRQFFFPPHNTLHGVDDNISKSKKILTAMSRRMSRDKWIMGSIISVFVFAILLILYFKLTR 421
            IK+SRRT+LETEE GV  LQDLH QRQ     H TLHGVDDN+ KSKKILT M+RRM+R+KW +G+II+V V AI+ ILYFKLTR
Sbjct:  137 IKDSRRTILETEELGVSILQDLHGQRQSLLRAHETLHGVDDNVGKSKKILTTMTRRMNRNKWTIGAIITVLVLAIIFILYFKLTR 221          
BLAST of CN185507 vs. ExPASy Swiss-Prot
Match: VTI11_ARATH (Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana GN=VTI11 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 1.065e-25
Identity = 55/85 (64.71%), Postives = 67/85 (78.82%), Query Frame = -3
Query:  167 IKESRRTMLETEEFGVLFLQDLHYQRQFFFPPHNTLHGVDDNISKSKKILTAMSRRMSRDKWIMGSIISVFVFAILLILYFKLTR 421
            +K+SRRTM+ETEE GV  LQDLH QRQ     H TLHGVDDNI KSKKILT M+RRM+++KW +G+II   + AI +ILYFKLT+
Sbjct:  137 VKDSRRTMMETEEIGVSILQDLHGQRQSLLRAHETLHGVDDNIGKSKKILTDMTRRMNKNKWTIGAIIIALIAAIFIILYFKLTK 221          
BLAST of CN185507 vs. ExPASy Swiss-Prot
Match: VTI12_ARATH (Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana GN=VTI12 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 1.102e-22
Identity = 52/84 (61.90%), Postives = 64/84 (76.19%), Query Frame = -3
Query:  170 IKESRRTMLETEEFGVLFLQDLHYQRQFFFPPHNTLHGVDDNISKSKKILTAMSRRMSRDKWIMGSIISVFVFAILLILYFKLT 421
            I+ESRR MLETEE G+  +QDL  QRQ     HN LHGVDD I KSKK+LTAMSRRM+R+KWI+ S+I   V AI+LI+ +KL+
Sbjct:  138 IRESRRLMLETEEVGISIVQDLSQQRQTLLHAHNKLHGVDDAIDKSKKVLTAMSRRMTRNKWIITSVIVALVLAIILIISYKLS 221          
The following BLAST results are available for this feature:
BLAST of CN185507 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
VTI13_ARATH1.486e-2769.41Vesicle transport v-SNARE 13 OS=Arabidopsis thalia... [more]
VTI11_ARATH1.065e-2564.71Vesicle transport v-SNARE 11 OS=Arabidopsis thalia... [more]
VTI12_ARATH1.102e-2261.90Vesicle transport v-SNARE 12 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H07_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185507 ID=CN185507|Name=CN185507|organism=Citrus sinensis|type=EST|length=423bp
ATTATGGTTTGTTTAATATTCTAGTTTCAGGCCTCCCAGGGCAGGGGGTC
ACGGGCTGGATCACATAAATGGAAAATTTGCAAAGGTTACTCCATAAGCA
TTGGGGGAAGGAGGGGAAGCAGCACAGGTTGCAAATGTATTCAACAACTT
GCACACCGGCAGGCTAACGAGTGAGCTTAAAATAAAGTATAAGTAAAATA
GCAAAAACAAAAACTGAAATTATGGAGCCCATGATCCATTTGTCCCTGCT
CATCCTTCTTGACATGGCTGTCAGGATCTTCTTGCTTTTGCTAATATTGT
CATCCACCCCATGGAGCGTGTTATGAGGGGGGAAAAAAAATTGGCGTTGA
TAATGCAAATCTTGCAGGAACAAAACTCCAAACTCTTCCGTTTCCAGCAT
TGTTCTTCTACTCTCCTTAATTC
back to top