CN185504

Overview
NameCN185504
Unique NameCN185504
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length822
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5453 contig Csv1_Contig5453:57..878. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK5_ARATH (Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 2.215e-43
Identity = 94/149 (63.09%), Postives = 109/149 (73.15%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLAS----DAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWK 441
            FVGKCLE VS+RLPAKELL DPFLA+    D      +PQ  + QNL  NG V+E +P     +D  ++TDM+ITG MN ED TIFL+VQI D DG  RNI FPF+I +DT  EVALEMVKELEITDW+PLEIA MIE EIS LVPNW+
Sbjct:  260 FVGKCLETVSRRLPAKELLADPFLAATDERDLAPLFRLPQQLAIQNLAANGTVVEHLPS---TTDPTRTTDMSITGKMNSEDHTIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIAAMIENEISLLVPNWR 405          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK4_ARATH (Probable serine/threonine-protein kinase WNK4 OS=Arabidopsis thaliana GN=WNK4 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.261e-30
Identity = 98/265 (36.98%), Postives = 129/265 (48.68%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYXXXXXXXXXXGIYHPFYXXXXXXXXXXXLPAFFTN-NANSPPSWLQQEDLLGNDDASSNGSVSSFKYSSWDYHSGNEDDSEFSHRAGEPLCIARATQKSTRFCPE 798
            F+GKCL + SKR+ AKELL DPFLASD    +           NP   + E         D    T+M+I G +  ED+ I L+VQI   +G A N++FPFDI NDT+ +VA EMVKELEI DWEP+EIA+MI+  ISSLV +WK     +  H H                 H                A  +N  A     W+ Q+DL  +D+  S  S  S  YS+ +Y + +E  S+          +   T   TRFCPE
Sbjct:  254 FIGKCLVSASKRVSAKELLQDPFLASDESWMVYTSGAG-----NPKPFLNENEMDTLKLEDDELRTEMSIAGKLGAEDNKIDLEVQIAYDNGLANNVFFPFDIMNDTSIDVAKEMVKELEIIDWEPVEIAKMIDGAISSLVSDWKYEEDDETPHDHH---------------RHRTDSFHSSSSHASSSQASLSNYMARGLQDWV-QDDL--HDETYSQSSSHSGSYSNLNYIAVDEYSSQSP--------VMSRTHNMTRFCPE 487          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK7_ORYSJ (Probable serine/threonine-protein kinase WNK7 OS=Oryza sativa subsp. japonica GN=WNK7 PE=2 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 2.013e-28
Identity = 86/189 (45.50%), Postives = 100/189 (52.91%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFL------------ASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYXXXXXXXXXXGIYHPFY 537
            F+G+CL + + R  A+ELLLDPFL            A     P  +P   S    N +    E  P  A      K+TDM ITG +N E DTIFLKVQI       RNIYFPFD+ NDTA EVA EMVKEL+I D EP EIA MIEQEI  LVP +K         QH +SY          G  +PFY
Sbjct:  268 FIGRCLVDAAHRPSAEELLLDPFLSPSQNHDDHNIIAHATAPPPPLPLACS----NSSEEQEEAAPAPAA-----KTTDMAITGKLNKEHDTIFLKVQIGG-GRNVRNIYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQEIVRLVPGYK---------QHEYSYADDNDDDDVSGHPNPFY 437          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK8_ORYSJ (Probable serine/threonine-protein kinase WNK8 OS=Oryza sativa subsp. japonica GN=WNK8 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.629e-28
Identity = 80/179 (44.69%), Postives = 99/179 (55.31%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLA--SDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYXXXXXXXXXXGIYHPFY 537
            F+G+CL + + R  A+ELLLDPFL+   +  +   I    +     P         +   ++   K+T M ITG +N E DTIFLKVQI    G  RNIYFPFD+ NDTA EVA EMVKEL+I D EP EIA MIEQEI  LVP +K         QH +SY          G  +PFY
Sbjct:  268 FIGRCLVDAAHRPSAEELLLDPFLSPPQNHDDHNTIAHATAPPPPLPLACSNSSEEQEEEEAPAAKTTGMAITGKLNKEHDTIFLKVQIGG-GGNVRNIYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQEIVRLVPGYK---------QHEYSYADDDDDDDVNGQPNPFY 436          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK2_ARATH (Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana GN=WNK2 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.816e-22
Identity = 65/164 (39.63%), Postives = 93/164 (56.71%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMEL-------------------VPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWK 441
            FV KCL NV+ RL A ELL DPFL  D  +  ++  +  +   +  G  +                     +  FA D +     D++I G  N  DD IFL+++I+D +G+ RNIYFPF+   DTA  VA+EMV EL+IT+ +  +IAEMI+ EI++LVP+WK
Sbjct:  258 FVEKCLANVTCRLTALELLQDPFLQDDNMDGFVMRPIDYYNGYDETGVFLRHPLIDDPLYHDQFESSQICEIDLFANDDEDH--VDISIKGKRNG-DDGIFLRLRISDAEGRIRNIYFPFETAIDTAWSVAVEMVSELDITNQDVAKIAEMIDAEIAALVPDWK 418          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK1_ORYSJ (Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. japonica GN=WNK1 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.816e-22
Identity = 74/197 (37.56%), Postives = 99/197 (50.25%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLASDA-------GEPLLIPQV--PSFQNLNPNGAVMELVPKFAVDSDRRK----------------------------STDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWK------ECGSPQFCH 468
            FV KCL   S+RL A+ELL DPFL  D        G+  L+  +  P  ++   N ++M      ++D D                               + D+TI G  + ED +IFL+++I D DG  RNIYFPFDI  DTA  VA EMV EL+ITD E   IAEMI+ E+S+LVP+W+      E     +CH
Sbjct:  261 FVEKCLATASRRLSARELLKDPFLQVDDLVFCPGDGDYSLMNYLRQPYLEHAYSNVSMMSNGLSESIDEDTPTEDRWDCEDDDIKADGIDLFNGHEDEPLGNVDITIKGRKS-EDGSIFLRLRIADNDGHVRNIYFPFDIEADTALSVATEMVAELDITDHEVTRIAEMIDGEVSALVPDWRPGPGIEESQDTTYCH 456          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK1_ORYSI (Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. indica GN=WNK1 PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 2.816e-22
Identity = 74/197 (37.56%), Postives = 99/197 (50.25%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLASDA-------GEPLLIPQV--PSFQNLNPNGAVMELVPKFAVDSDRRK----------------------------STDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWK------ECGSPQFCH 468
            FV KCL   S+RL A+ELL DPFL  D        G+  L+  +  P  ++   N ++M      ++D D                               + D+TI G  + ED +IFL+++I D DG  RNIYFPFDI  DTA  VA EMV EL+ITD E   IAEMI+ E+S+LVP+W+      E     +CH
Sbjct:  261 FVEKCLATASRRLSARELLKDPFLQVDDLVFCPGDGDYSLMNYLRQPYLEHAYSNVSMMSNGLSESIDEDTPTEDRWDCEDDDIKADGIDLFNGHEDEPLGNVDITIKGRKS-EDGSIFLRLRIADNDGHVRNIYFPFDIEADTALSVATEMVAELDITDHEVTRIAEMIDGEVSALVPDWRPGPGIEESQDTTYCH 456          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK9_ARATH (Probable serine/threonine-protein kinase WNK9 OS=Arabidopsis thaliana GN=WNK9 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.231e-19
Identity = 71/184 (38.59%), Postives = 94/184 (51.09%), Query Frame = 1
Query:    4 GFVGKCLENVSKRLPAKELLLDPFLASD----------------AGEPLLIP-QVPSFQN------------LNPNGAV----MELVPKFAVDSDRRK------STDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNW 438
            GF+ KCL  VS RL A ELL D FL  D                AG PL     +P + N             N +  V    ++L+ +F  D D  +      S D++I G      D +FL+++  +K+G  RNIYFPFDI  DTA  VA EMV+ELE+ D +  +IA MI+ EI+SLVPNW
Sbjct:  258 GFIEKCLATVSLRLSACELLDDHFLCIDESDMRRVESEKGLIDEAGTPLRHSYHIPHYSNGYYSLYNQNQWDYNGDETVESHEIDLL-EFQNDDDEEEEDKRFGSVDISIKGKRRDNGDGLFLRLKTVNKEGCVRNIYFPFDIETDTAISVAREMVEELEMDDRDVTKIANMIDGEIASLVPNW 440          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK2_ORYSJ (Probable serine/threonine-protein kinase WNK2 OS=Oryza sativa subsp. japonica GN=WNK2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.478e-19
Identity = 63/176 (35.80%), Postives = 91/176 (51.70%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNG-----------------AVMELVPKFAVDSDRRKSTDMTITGTMNPED---------------DTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNW 438
            F+ KC+   S+RL A+ELL+DPFL  D GE +  P   + +  +  G                 A+ E    FA +      +D  I  TM+P+                +TIFLK++I D  G A+NI+FPFDI  DT+  VA EMV +L++TD +   IAEMI+ EI + +P+W
Sbjct:  263 FIEKCIAKASQRLSAQELLMDPFLRDD-GEKIFYPLQSNTKASDGAGSSNSSMGYKYDRDASSMAIREHTGSFAEEHP----SDRYIHSTMDPQAAAGRIITVESQMKDLNTIFLKLRIADSTGHAQNIHFPFDIEADTSISVATEMVVQLDLTDQDVTAIAEMIDAEIRAHIPDW 433          
BLAST of CN185504 vs. ExPASy Swiss-Prot
Match: WNK3_ARATH (Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana GN=WNK3 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.107e-18
Identity = 62/145 (42.76%), Postives = 86/145 (59.31%), Query Frame = 1
Query:    7 FVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLE-IAEMIEQEISSLVPNW 438
            F+ KC+  VS+RL AKELL DPFL         +         N NG V +L       SD      +T+ G    + +TIFLK++ITD  GQ RNI+FPF+I  DT+  VA+EMV+EL++TD + +  IA+MI+ EI S +P+W
Sbjct:  257 FIEKCIAKVSQRLSAKELLDDPFLKCYKENTENVSSHKE-NGYNGNGIVDKL-------SDSEVGL-LTVEG-QRKDLNTIFLKLRITDSKGQIRNIHFPFNIETDTSFSVAIEMVEELDLTDDQDISTIAKMIDTEIHSHIPDW 391          
The following BLAST results are available for this feature:
BLAST of CN185504 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
WNK5_ARATH2.215e-4363.09Probable serine/threonine-protein kinase WNK5 OS=A... [more]
WNK4_ARATH1.261e-3036.98Probable serine/threonine-protein kinase WNK4 OS=A... [more]
WNK7_ORYSJ2.013e-2845.50Probable serine/threonine-protein kinase WNK7 OS=O... [more]
WNK8_ORYSJ2.629e-2844.69Probable serine/threonine-protein kinase WNK8 OS=O... [more]
WNK2_ARATH2.816e-2239.63Serine/threonine-protein kinase WNK2 OS=Arabidopsi... [more]
WNK1_ORYSJ2.816e-2237.56Probable serine/threonine-protein kinase WNK1 OS=O... [more]
WNK1_ORYSI2.816e-2237.56Probable serine/threonine-protein kinase WNK1 OS=O... [more]
WNK9_ARATH2.231e-1938.59Probable serine/threonine-protein kinase WNK9 OS=A... [more]
WNK2_ORYSJ8.478e-1935.80Probable serine/threonine-protein kinase WNK2 OS=O... [more]
WNK3_ARATH1.107e-1842.76Probable serine/threonine-protein kinase WNK3 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H05_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185504 ID=CN185504|Name=CN185504|organism=Citrus sinensis|type=EST|length=822bp
GAGGGTTTTGTGGGGAAATGTTTGGAGAATGTTTCAAAAAGGTTACCAGC
TAAAGAGCTCTTGCTCGACCCGTTTCTAGCTTCTGATGCAGGGGAGCCCT
TGCTTATCCCACAAGTCCCAAGTTTTCAAAATTTAAATCCTAATGGAGCA
GTGATGGAGCTAGTGCCAAAGTTTGCGGTTGATTCTGATCGAAGGAAGAG
TACTGATATGACCATAACAGGCACAATGAATCCTGAAGATGATACAATTT
TCCTGAAAGTACAGATTACAGACAAAGATGGTCAAGCTAGAAACATATAC
TTCCCCTTTGACATTTTCAATGATACTGCAACTGAAGTTGCCTTGGAGAT
GGTGAAAGAATTGGAGATTACTGATTGGGAACCACTTGAAATTGCTGAAA
TGATAGAGCAAGAAATATCTTCTTTGGTCCCGAATTGGAAGGAATGTGGC
TCTCCTCAATTCTGTCATCAACACAGCTTTAGCTATGAAGATGAAGATGA
TGACAATGACGACGATGGAATCTACCACCCTTTCTACTCTAACTCTTCCC
ATTCCTCGTCGCACGCTTCTCTCCCAGCTTTCTTCACAAACAATGCGAAT
TCTCCTCCCAGTTGGCTTCAACAAGAAGACTTGTTGGGCAATGATGATGC
GAGTTCCAATGGTTCTGTTAGTTCTTTCAAGTACTCAAGCTGGGATTACC
ACTCAGGCAATGAAGATGATTCTGAGTTCAGCCACAGAGCAGGAGAGCCA
CTCTGCATTGCAAGGGCAACTCAAAAATCTACAAGATTCTGCCCTGAAGC
TGCTATGAACAATGACCGCTGC
back to top