CN185492

Overview
NameCN185492
Unique NameCN185492
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length763
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2488 contig Csv1_Contig2488:1..763. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185492 vs. ExPASy Swiss-Prot
Match: WDR53_MOUSE (WD repeat-containing protein 53 OS=Mus musculus GN=Wdr53 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.247e-22
Identity = 66/203 (32.51%), Postives = 105/203 (51.72%), Query Frame = 1
Query:   55 GHKATATCCIASRDRPGFVASSGEDGCICWFDLRSKDVQLVTDVGNGPVSSLCFKSGNEDIIYVSSGKEVKSFDVHMPASWRPLESYNYNKEEINQIVCNPKSSFLACADDGGDVKIIDIRQHCLYKSLRAGHSSICSSVQFIPWKPWEVISGGLDSKLVMWDFSKGRPNKIVNFGLPENN-----GNAGQCYNPAFVHAIAI 648
            GH ++  C  A++D  G VAS GE G +  +      +  +   G   V+S+ F +     +Y S G+ +   DV        L+ ++ N+EEIN +  N   S LA ADD G +KI+D+ +  + +SL+  HS+ICSSV F P +P  ++S GLD ++++W   K RP  I N    E          G+  NPA  H++++
Sbjct:    8 GHSSSILCLNANKD--GLVASGGEGGDLVAWGEDGTPLGHMQLEGADDVTSVLFSASCPTKLYASHGETISVLDVRSLKG--SLDHFHVNEEEINCLSLNETESLLASADDSGAIKILDLEKKKVTRSLKR-HSNICSSVAFRPQRPQSLVSCGLDMQVMLWSLQKARPVWITNLQEDETEETEGPQTPGRLLNPALAHSVSV 205          
BLAST of CN185492 vs. ExPASy Swiss-Prot
Match: WDR53_BOVIN (WD repeat-containing protein 53 OS=Bos taurus GN=WDR53 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.614e-21
Identity = 68/207 (32.85%), Postives = 107/207 (51.69%), Query Frame = 1
Query:   55 GHKATATCCIASRDRPGFVASSGEDG-CICWFDLRSKDVQLVTDV---GNGPVSSLCFKSGNEDIIYVSSGKEVKSFDVHMPASWRPLESYNYNKEEINQIVCNPKSSFLACADDGGDVKIIDIRQHCLYKSLRAGHSSICSSVQFIPWKPWEVISGGLDSKLVMWDFSKGRPNKIVNFGLPENN-----GNAGQCYNPAFVHAIAI 648
            GH +   C  AS++  G VAS  E G  + W     +D  L+      G   V+++ F       +Y S G+ +   DV   +   PL+ ++ N+EEIN +  N   + LA ADD G +KI+D+    + +SL+  HS+ICSSV F P +P  ++S GLD ++++W+  K RP  I N    E        + GQ  NPA  H++++
Sbjct:    8 GHSSPILCLNASQE--GLVASGAEGGDLVVW----GEDGTLLGHTCFQGAEDVTNVLFSPSCPTKLYASHGETISILDVR--SLKEPLDDFHVNEEEINCLSLNETENLLASADDSGTIKILDLENKKISRSLKR-HSNICSSVAFRPQRPQSLVSCGLDMQVMLWNLRKARPLWITNLQEDETEEMESPQSPGQLLNPALAHSVSV 205          
BLAST of CN185492 vs. ExPASy Swiss-Prot
Match: WDR53_HUMAN (WD repeat-containing protein 53 OS=Homo sapiens GN=WDR53 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 6.132e-21
Identity = 65/203 (32.02%), Postives = 101/203 (49.75%), Query Frame = 1
Query:   55 GHKATATCCIASRDRPGFVASSGEDGCICWFDLRSKDVQLVTDVGNGPVSSLCFKSGNEDIIYVSSGKEVKSFDVHMPASWRPLESYNYNKEEINQIVCNPKSSFLACADDGGDVKIIDIRQHCLYKSLRAGHSSICSSVQFIPWKPWEVISGGLDSKLVMWDFSKGRPNKIVNFGLPENN-----GNAGQCYNPAFVHAIAI 648
            GH +   C  AS++  G +AS  E G +  +      +      G   V+S+ F       +Y S G+ +   DV        L+ ++ N+EEIN +  N   + LA ADD G +KI+D+    + +SL+  HS+ICSSV F P +P  ++S GLD ++++W   K RP  I N    E        + GQ  NPA  H+I++
Sbjct:    8 GHSSPVLCLNASKE--GLLASGAEGGDLTAWGEDGTPLGHTRFQGADDVTSVLFSPSCPTKLYASHGETISVLDVRSLKD--SLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKR-HSNICSSVAFRPQRPQSLVSCGLDMQVMLWSLQKARPLWITNLQEDETEEMEGPQSPGQLLNPALAHSISV 205          
BLAST of CN185492 vs. ExPASy Swiss-Prot
Match: WDR53_DICDI (WD repeat-containing protein 53 homolog OS=Dictyostelium discoideum GN=wdr53 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.973e-19
Identity = 72/247 (29.15%), Postives = 119/247 (48.18%), Query Frame = 1
Query:   46 RLRGHKATATCCIASRDRPGFVASSGEDGCICWFDLRS-KDVQLVTDVGNG-PVSSLCFKSGNEDIIYVSSGKEVKSFDVHMP-ASWRPLES-YNYNKEEINQIVCNPKSSFLACADDGGDVKIIDIRQHCLYKSLRAGHSSICSSVQFIPWKPWEVISGGLDSKLVMWDFSKGRPNKIVNF---GLPENNGNAGQ----------CYNPAFVHAIAIPDADMLDKTNKICVVAKGDGVVDVINIES 735
            +L GHK T  C I+S ++   +AS  +D  +  +DL + K +Q + +   G PV+++CF    +  +Y S    + SFD+  P    +   + Y +N EEINQ+  + K  +LA  DD G  KIID+ ++ L +SL   H++I +   F P    E+I+  +D  ++ WDF K +      F    LP+N   + Q            NP FV ++           +K   ++ GDG + +  I S
Sbjct:   24 KLIGHKDTVLC-ISSHNKKEIIASGSDDCTVRIWDLNTNKSIQSIVEGFQGNPVNNVCFDQ--DFTLYCSYDNIIVSFDLRQPNVILKEFNTQYKFNTEEINQLSFDSKYQYLAACDDSGQTKIIDVTKNKLVESLNKKHTNIATGCVFRPNSKNELITSSMDFSIIHWDFLKAKVLHRDTFKEGSLPQNISKSQQQQQETTEPNRMLNPPFVTSVD------CSNNSKYVAISMGDGTIVINEISS 261          
The following BLAST results are available for this feature:
BLAST of CN185492 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
WDR53_MOUSE4.247e-2232.51WD repeat-containing protein 53 OS=Mus musculus GN... [more]
WDR53_BOVIN1.614e-2132.85WD repeat-containing protein 53 OS=Bos taurus GN=W... [more]
WDR53_HUMAN6.132e-2132.02WD repeat-containing protein 53 OS=Homo sapiens GN... [more]
WDR53_DICDI1.973e-1929.15WD repeat-containing protein 53 homolog OS=Dictyos... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001G20_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001G20, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185492 ID=CN185492|Name=CN185492|organism=Citrus sinensis|type=EST|length=763bp
CGACGGGTCGGTACGAGTATGACCGACGCAGAGGCGAAGCCACGACGGTT
GAGAGGTCACAAGGCCACTGCCACGTGTTGCATAGCCTCACGTGACCGCC
CTGGCTTTGTTGCCTCTTCTGGGGAGGATGGTTGCATTTGCTGGTTTGAT
TTGAGAAGCAAAGACGTGCAGCTTGTCACTGATGTTGGAAATGGACCTGT
TTCTTCACTTTGTTTCAAGTCAGGGAATGAAGACATTATCTACGTTTCCT
CGGGAAAGGAAGTCAAATCTTTTGATGTGCATATGCCTGCATCGTGGAGG
CCATTAGAGAGCTACAACTATAACAAAGAGGAGATAAATCAGATCGTGTG
CAACCCTAAGTCATCTTTTCTTGCTTGCGCAGATGATGGTGGTGATGTTA
AGATCATTGATATTCGCCAGCATTGCCTTTATAAATCACTGAGAGCTGGC
CATTCAAGTATCTGTAGCAGTGTGCAATTCATACCCTGGAAACCTTGGGA
AGTCATTTCTGGAGGTCTGGATTCAAAGCTTGTCATGTGGGACTTCTCCA
AAGGGCGTCCAAACAAGATTGTGAATTTTGGCTTACCTGAAAACAATGGT
AATGCTGGGCAATGCTATAACCCTGCTTTTGTGCATGCAATAGCAATTCC
AGATGCTGATATGTTAGACAAAACAAACAAAATATGTGTCGTTGCTAAGG
GTGATGGTGTTGTTGATGTGATCAATATTGAATCAGAACTTAATATAAGT
AGGTCAAAAAGTA
back to top