CN185484

Overview
NameCN185484
Unique NameCN185484
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length709
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185484_ssr588 microsatellite CN185484_ssr588:588..597. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2486 contig Csv1_Contig2486:1..709. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC1_PEA (Pyruvate decarboxylase isozyme 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 9.678e-87
Identity = 149/163 (91.41%), Postives = 158/163 (96.93%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PENCGYEFQMQYGSIGWSVGATLGYAQAA DKRVIACIGDGSFQVTAQ+ISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTG V+AIHNG+GKCWTAKVR+E++LTEA+ TATG +KDSLCFIEVF HKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct:  431 PENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGFVSAIHNGQGKCWTAKVRTEEDLTEAIATATGAEKDSLCFIEVFAHKDDTSKELLEWGSRVAAANSRPPNPQ 593          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC1_MAIZE (Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PDC1 PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 7.669e-84
Identity = 144/163 (88.34%), Postives = 153/163 (93.87%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQ++STM+RCGQ+SIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHN EG CWT KVR+E++L EA+ T TG +KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  448 PEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNSEGNCWTMKVRTEEQLKEAIATVTGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ 610          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSJ (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 8.479e-83
Identity = 140/163 (85.89%), Postives = 154/163 (94.48%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGATLGYAQAAKDKRVI+CIGDGSFQ+TAQ++STM+RCGQ+SIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGL++AIHN +G CWT KVR+E+EL EA+ TATG +KD LCFIE+ VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  443 PEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATATGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ 605          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSI (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 8.479e-83
Identity = 140/163 (85.89%), Postives = 154/163 (94.48%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGATLGYAQAAKDKRVI+CIGDGSFQ+TAQ++STM+RCGQ+SIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGL++AIHN +G CWT KVR+E+EL EA+ TATG +KD LCFIE+ VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  443 PEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATATGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ 605          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSI (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2)

HSP 1 Score: 303.908 bits (777), Expect = 5.496e-82
Identity = 142/163 (87.12%), Postives = 151/163 (92.64%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGA LGYAQ AKDKRVIACIGDGSFQVTAQ++STMIRC Q SIIFLINNGGYTIEVEIHDGPYNVIKNW+YTGLV+AIHNGEGKCWT+KV+ E+ELTEA+  A GE+KD LCFIEV  HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  444 PEGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMIRCAQNSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTEAIGMALGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ 606          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC2_PEA (Pyruvate decarboxylase isozyme 2 (Fragment) OS=Pisum sativum GN=PDC2 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 9.374e-82
Identity = 141/163 (86.50%), Postives = 152/163 (93.25%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGATLGYAQA  +KRVIACIGDGSFQVTAQ++STM+RCGQ++IIFLINNGGYTIEVEIHDGPYNVIKNW+YTGLV+AIHNGEGKCWT KV  E+EL EA+  ATG +KDSLCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  243 PEGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVFCEEELVEAIAKATGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ 405          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSJ (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.768e-80
Identity = 142/163 (87.12%), Postives = 150/163 (92.02%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGA LGYAQ AKDKRVIACIGDGSFQVTAQ++STMIRC Q SIIFLINNGGYTIEVEIHDGPYNVIKNW+YTGLV+AIHNGEGKCWT+KV+ E+ELTEA+  A GE KD LCFIEV  HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  444 PEGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMIRCAQNSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTEAIGMALGE-KDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ 605          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC3_ORYSJ (Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 1.955e-79
Identity = 138/163 (84.66%), Postives = 149/163 (91.41%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGA LGYAQA + KRV+ACIGDGSFQVTAQ++STM+RCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDY GLVNAIHNGEG+CW  +VR E+EL  A+ TATG++ DSLCFIEV  HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  426 PEGCGYEFQMQYGSIGWSVGALLGYAQAVQ-KRVVACIGDGSFQVTAQDVSTMLRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVNAIHNGEGRCWATRVRCEEELEAAIATATGDKADSLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ 587          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC3_ORYSI (Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=2 SV=2)

HSP 1 Score: 295.434 bits (755), Expect = 1.955e-79
Identity = 138/163 (84.66%), Postives = 149/163 (91.41%), Query Frame = 2
Query:    5 PENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            PE CGYEFQMQYGSIGWSVGA LGYAQA + KRV+ACIGDGSFQVTAQ++STM+RCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDY GLVNAIHNGEG+CW  +VR E+EL  A+ TATG++ DSLCFIEV  HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct:  426 PEGCGYEFQMQYGSIGWSVGALLGYAQAVQ-KRVVACIGDGSFQVTAQDVSTMLRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVNAIHNGEGRCWATRVRCEEELEAAIATATGDKADSLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ 587          
BLAST of CN185484 vs. ExPASy Swiss-Prot
Match: PDC2_TOBAC (Pyruvate decarboxylase isozyme 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 3.686e-78
Identity = 135/160 (84.38%), Postives = 148/160 (92.50%), Query Frame = 2
Query:   14 CGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTATGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ 493
            C YEFQMQYGSIGWSVGATLGYAQ+   KRVI+CIGDGSFQVTAQ++STMIRC Q++IIFLINNGGYTIEVEIHDGPYNVIKNW+YTGLV+AIHNGEG CWT KVR+E+ELTEA+ TATGE+KD LCFIEV VHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct:  455 CRYEFQMQYGSIGWSVGATLGYAQSVPKKRVISCIGDGSFQVTAQDVSTMIRCEQKNIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTMKVRTEEELTEAIATATGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ 614          
The following BLAST results are available for this feature:
BLAST of CN185484 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
PDC1_PEA9.678e-8791.41Pyruvate decarboxylase isozyme 1 OS=Pisum sativum ... [more]
PDC1_MAIZE7.669e-8488.34Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PD... [more]
PDC1_ORYSJ8.479e-8385.89Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]
PDC1_ORYSI8.479e-8385.89Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]
PDC2_ORYSI5.496e-8287.12Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC2_PEA9.374e-8286.50Pyruvate decarboxylase isozyme 2 (Fragment) OS=Pis... [more]
PDC2_ORYSJ1.768e-8087.12Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC3_ORYSJ1.955e-7984.66Pyruvate decarboxylase isozyme 3 OS=Oryza sativa s... [more]
PDC3_ORYSI1.955e-7984.66Pyruvate decarboxylase isozyme 3 OS=Oryza sativa s... [more]
PDC2_TOBAC3.686e-7884.38Pyruvate decarboxylase isozyme 2 OS=Nicotiana taba... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001G14_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001G14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185484 ID=CN185484|Name=CN185484|organism=Citrus sinensis|type=EST|length=709bp
GCGGCCCGAGAATTGTGGATATGAATTTCAGATGCAGTATGGATCCATTG
GCTGGTCAGTTGGTGCCACCCTAGGATATGCTCAGGCTGCTAAAGATAAG
CGTGTGATTGCTTGCATTGGTGATGGAAGTTTCCAGGTAACTGCTCAGGA
GATATCAACGATGATTCGATGTGGACAAAGGAGCATCATATTCCTTATCA
ACAATGGCGGGTATACAATTGAAGTAGAGATTCATGATGGGCCTTACAAT
GTGATTAAGAACTGGGATTATACTGGCCTGGTAAATGCCATCCACAATGG
AGAAGGAAAATGCTGGACTGCCAAGGTGCGGAGTGAAGATGAACTAACAG
AAGCAATGAAGACAGCTACTGGAGAACAAAAAGATTCTCTATGTTTTATC
GAAGTATTTGTGCACAAGGATGACACCAGCAAAGAGCTGCTGGAGTGGGG
ATCCAGGGTTTCTGCAGCCAACAGCCGCCCTCCAAATCCTCAATAGCACT
TTGAAGTGTTGAGGATTTTGAGTTTCTGTTATTTCAACTGCAGTATTCTT
GGCCTATATCCTAAAACATGTATCAAAGCTAGAAATAAGAGAGAGAGGAT
TGTTTGATTTAGATGGTTTCCCACCTATCTGTTGGCAGCGATCTGGTTTC
TGTTGTGATTATGCATTTGTTGTTATCTGTTGTGATTATGCATTTGTTGT
TATGTACAT
back to top