CN185482

Overview
NameCN185482
Unique NameCN185482
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length776
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185482 vs. ExPASy Swiss-Prot
Match: PFD4_AVEFA (Probable prefoldin subunit 4 OS=Avena fatua GN=VIP3 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.589e-35
Identity = 73/124 (58.87%), Postives = 87/124 (70.16%), Query Frame = 2
Query:   44 EQAEKSDTVVTWEDQQNINKFSKLNNRFHELEDEIKFAKETNDNLEDAGNELILTDEDIVRFQIGEVFAHVPXXXXXXXXXXXXXXNSXXXXXXXXXXXXVLAQMNELKKILYGKFRDSINLEE 415
            +Q + ++  VTWEDQQNIN+F +LNNRFHEL DEI+ AKE N+NLEDAGNELIL DED+VRFQIGEVFAH+P               +            +LAQM ELKKILYGKF+D+INLEE
Sbjct:    2 QQGDGTEAQVTWEDQQNINRFGRLNNRFHELTDEIRLAKEANENLEDAGNELILCDEDVVRFQIGEVFAHMPMDDVEARLEQMKEDAAKKLERLEEEKESILAQMAELKKILYGKFKDAINLEE 125          
BLAST of CN185482 vs. ExPASy Swiss-Prot
Match: PFD4_ARATH (Probable prefoldin subunit 4 OS=Arabidopsis thaliana GN=API3 PE=1 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 9.600e-30
Identity = 67/119 (56.30%), Postives = 79/119 (66.39%), Query Frame = 2
Query:   59 SDTVVTWEDQQNINKFSKLNNRFHELEDEIKFAKETNDNLEDAGNELILTDEDIVRFQIGEVFAHVPXXXXXXXXXXXXXXNSXXXXXXXXXXXXVLAQMNELKKILYGKFRDSINLEE 415
            S+  VTWEDQQNIN FS+LNNR H+L+D+IK AKE  +NLEDAGNELIL DE++VRFQIGEVFAHVP                            ++ QM  LKK+LY KF+DSINLEE
Sbjct:    9 SEMEVTWEDQQNINIFSRLNNRVHDLDDDIKSAKEKCENLEDAGNELILADEEMVRFQIGEVFAHVPRDDVETKIEEMKEATCKSLEKLEQEKESIVTQMAALKKVLYAKFKDSINLEE 127          
The following BLAST results are available for this feature:
BLAST of CN185482 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PFD4_AVEFA7.589e-3558.87Probable prefoldin subunit 4 OS=Avena fatua GN=VIP... [more]
PFD4_ARATH9.600e-3056.30Probable prefoldin subunit 4 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001G13_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001G13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185482 ID=CN185482|Name=CN185482|organism=Citrus sinensis|type=EST|length=776bp
AGGGTTTCTCCGCAGACAGCACTCGAACTTCACGATGCAACATGAACAGG
CTGAGAAATCTGATACGGTGGTGACATGGGAAGATCAACAAAACATTAAC
AAATTTTCCAAATTAAACAACAGATTCCATGAGCTTGAAGATGAAATCAA
GTTTGCCAAGGAAACAAATGATAATCTGGAGGATGCAGGCAATGAATTGA
TTCTCACTGATGAAGACATAGTTCGCTTCCAAATAGGCGAAGTCTTTGCT
CATGTGCCAAGGGAAGAAGTGGAGATCAGAATAGAAGAGATGAAAGAGGT
GAATAGCAAAACTCTGGAAAAACTTGAGAAAGAGAAGGAAACTGTTCTGG
CCCAAATGAATGAATTGAAGAAGATTCTATACGGGAAGTTCAGGGACTCT
ATCAACTTAGAGGAGTATTAATACACCATGACTGTCATTTCTCTGTAATT
TGGTTGCCTCTCTCTTTTGATTTAAATATTAGGGATGACTGTGCTCCAAT
CTTCAACTTGCAATTGAGTATCCTGAGTGAAGCTAGTGCCGATTTTACAA
AAATAACAAAATCCTTTACCCTCAACAAAACTAAATGGTAACTCATCAAG
CACAACCATTTTAGCACAAGCTTTCCTACATTCTTCTTTATCAAAAGAAA
CAATTGTAGTACTAGAAGCACTAGTGTGAGGAGGTTTACTACTTTGCTCT
GATTCATCTACTTTAGTTGCTAAGTAATTTTCACAAACCTTAAGATGATT
GTTCATATTAGTAGTCCCATTTTTCA
back to top