CN185478

Overview
NameCN185478
Unique NameCN185478
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length743
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig760 contig Csv1_Contig760:869..1610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJH_CUCSA (DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 3.845e-73
Identity = 130/143 (90.91%), Postives = 139/143 (97.20%), Query Frame = -2
Query:  314 VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 742
            VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSL E+LCGFQF++THLDGRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFSV+FP+SL+P+QCK LE VLPPRTSVQL+DMELDECEETTLHDVNIEEEMRRK
Sbjct:  247 VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLVESLCGFQFILTHLDGRQLLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPEQCKALEGVLPPRTSVQLSDMELDECEETTLHDVNIEEEMRRK 389          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJH2_ALLPO (DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.047e-70
Identity = 125/143 (87.41%), Postives = 135/143 (94.41%), Query Frame = -2
Query:  314 VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 742
            VTGDIVFVLQQKEHPKFKRKGDDLF EH+LSLTEALCGFQFV+THLD RQLLIKS PGEV+KPDQFK INDEGMPMYQRPFMRGKLYIHFSVDFP+SL+PDQCK LE+VLP R + +LTDME+DECEETT+HDVNIEEEMRRK
Sbjct:  249 VTGDIVFVLQQKEHPKFKRKGDDLFYEHSLSLTEALCGFQFVLTHLDNRQLLIKSNPGEVIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPDSLTPDQCKALESVLPSRNASRLTDMEIDECEETTMHDVNIEEEMRRK 391          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJH1_ALLPO (DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 6.786e-70
Identity = 125/143 (87.41%), Postives = 135/143 (94.41%), Query Frame = -2
Query:  314 VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 742
            VTGDIVFVLQQKEHPKF+RKGDDLF +HTLSLTEALCGFQFV+THLDGRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYI F VDFP+SL+PDQCK++E+VLP   S QLTDME+DECEETT+HDVNIEEEMRRK
Sbjct:  228 VTGDIVFVLQQKEHPKFQRKGDDLFYKHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDSLTPDQCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRK 370          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNAJ3_ARATH (Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2)

HSP 1 Score: 255.373 bits (651), Expect = 2.414e-67
Identity = 120/143 (83.92%), Postives = 134/143 (93.71%), Query Frame = -2
Query:  314 VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 742
            VTGDIVFVLQQKEHPKFKRKG+DLFVEHTLSLTEALCGFQFV+THLDGR LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHF+V+FP+SLSPDQ K LE VLP  ++ QL+DME+DECEETTLHDVNIE+EMRRK
Sbjct:  249 VTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRK 391          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJH_ATRNU (DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.945e-66
Identity = 118/143 (82.52%), Postives = 133/143 (93.01%), Query Frame = -2
Query:  314 VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 742
            VTGDIVFVLQQKEHPKFKRKG+DLF EHTLSLTEALCGF+FV+THLDGRQLLIKS  GEVVKPDQFKAI DEGMP+YQRPFM+GK+YIHF+V+FP+SL+PDQ K LE +LPP+ S+ LT MELDECEETTLH+VNIEEEM+RK
Sbjct:  249 VTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALCGFRFVLTHLDGRQLLIKSNLGEVVKPDQFKAIEDEGMPIYQRPFMKGKMYIHFTVEFPDSLNPDQVKSLEAILPPKPSMSLTYMELDECEETTLHNVNIEEEMKRK 391          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNAJ2_ARATH (Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2)

HSP 1 Score: 249.21 bits (635), Expect = 1.730e-65
Identity = 115/143 (80.42%), Postives = 133/143 (93.01%), Query Frame = -2
Query:  314 VTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 742
            VTGDIVFV+QQKEHPKFKRKG+DLFVEHT+SLTEALCGFQFV+THLD RQLLIKS+PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHF+V+FPESLSPDQ K +E VLP  T   ++DME+D+CEETTLHDVNIE+EM+RK
Sbjct:  250 VTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRK 392          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJA1_RAT (DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.998e-29
Identity = 66/142 (46.48%), Postives = 94/142 (66.20%), Query Frame = -2
Query:  317 GDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 736
            GDI+ VL QK+H  F R+G+DLF+   + L EALCGFQ  I+ LD R ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  237 GDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 374          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJA1_PONAB (DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.998e-29
Identity = 66/142 (46.48%), Postives = 94/142 (66.20%), Query Frame = -2
Query:  317 GDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 736
            GDI+ VL QK+H  F R+G+DLF+   + L EALCGFQ  I+ LD R ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  236 GDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 373          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJA1_MOUSE (DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.998e-29
Identity = 66/142 (46.48%), Postives = 94/142 (66.20%), Query Frame = -2
Query:  317 GDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 736
            GDI+ VL QK+H  F R+G+DLF+   + L EALCGFQ  I+ LD R ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  237 GDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 374          
BLAST of CN185478 vs. ExPASy Swiss-Prot
Match: DNJA1_HUMAN (DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.998e-29
Identity = 66/142 (46.48%), Postives = 94/142 (66.20%), Query Frame = -2
Query:  317 GDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 736
            GDI+ VL QK+H  F R+G+DLF+   + L EALCGFQ  I+ LD R ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  237 GDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 374          
The following BLAST results are available for this feature:
BLAST of CN185478 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
DNJH_CUCSA3.845e-7390.91DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 P... [more]
DNJH2_ALLPO1.047e-7087.41DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE... [more]
DNJH1_ALLPO6.786e-7087.41DnaJ protein homolog 1 (Fragment) OS=Allium porrum... [more]
DNAJ3_ARATH2.414e-6783.92Chaperone protein dnaJ 3 OS=Arabidopsis thaliana G... [more]
DNJH_ATRNU5.945e-6682.52DnaJ protein homolog ANJ1 OS=Atriplex nummularia P... [more]
DNAJ2_ARATH1.730e-6580.42Chaperone protein dnaJ 2 OS=Arabidopsis thaliana G... [more]
DNJA1_RAT1.998e-2946.48DnaJ homolog subfamily A member 1 OS=Rattus norveg... [more]
DNJA1_PONAB1.998e-2946.48DnaJ homolog subfamily A member 1 OS=Pongo abelii ... [more]
DNJA1_MOUSE1.998e-2946.48DnaJ homolog subfamily A member 1 OS=Mus musculus ... [more]
DNJA1_HUMAN1.998e-2946.48DnaJ homolog subfamily A member 1 OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001G11_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185478 ID=CN185478|Name=CN185478|organism=Citrus sinensis|type=EST|length=743bp
CCTTTTTTTTAATATTGTAAACACTAAAAATATTAATTATGAGCATTGAG
TCTGCACGTTGTTAACGCTAGAATTCCATTACATAGTCAGTTATCAGAAA
CATATAAGAATAAAGACAGACAAACCAAAACTAGAACCTCTAAAGCCTAT
AACAGAAAATAAATATGTTGAGAATCTTTTTCTCCCAAACAATGAAAATA
CTAAATCAGGCCACCCCTTTTCTTCTACATCATCACTGCTGAGCACACTG
CACTCTCTGGGCACCACCTTGCATATCGTCATCTTCATCGTATGCCTCCT
GAGCTGCTTGTTGCTTCCTTCGCATTTCCTCCTCAATGTTCACATCATGC
AGGGTTGTTTCTTCACACTCATCCAGTTCCATATCGGTGAGCTGGACTGA
GGTCCTTGGAGGTAGTACGGTCTCCAGCATCTTGCACTGGTCTGGGCTCA
GTGACTCAGGGAAGTCAACACTGAAATGAATGTACAGTTTGCCCCTCATA
AATGGCCTCTGATACATAGGCATTCCTTCATCATTTATGGCCTTGAATTG
GTCCGGCTTGACTACTTCCCCAGGCTGGGATTTGATGAGGAGTTGCCGGC
CATCCAAATGAGTTATTACAAATTGAAAGCCACAGAGAGCTTCTGTCAGT
GACAGGGTGTGCTCAACAAATAGGTCATCACCCTTTCGCTTAAATTTCGG
GTGCTCTTTCTGTTGTAGAACAAATACAATGTCACCTGTGACA
back to top