CN185475

Overview
NameCN185475
Unique NameCN185475
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length776
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185475 vs. ExPASy Swiss-Prot
Match: PTRB_MORLA (Protease 2 OS=Moraxella lacunata GN=ptrB PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.538e-14
Identity = 55/213 (25.82%), Postives = 101/213 (47.42%), Query Frame = -1
Query:  129 HKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKP-EELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDP-SESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVS 761
            H+L +D  +D  ++ EKDD ++L +  S+S KF+F+ S SK T  +  +D   P   L+++  R  G+     H  +   I      L N +LL CP+++ S    ++ + E   LQ++  F D L +  RE GL +I       +          + + + +P+Y++   SE  + +  +   Y SL TP + +  ++  G     ++  VS
Sbjct:  207 HRLGSDVESDELIFEEKDDTFTLFISKSQSGKFIFVYSSSKTTSEIHMIDTDSPLSPLQLVDERRDGILYDVEHWEDDLLILTNEGAL-NFQLLRCPLNDLSSKVNVVEYNEERYLQEMYPFRDKLLIAGRENGLTQIWVVHDGEL----------QQISWDEPLYTVAVLSEQSYDTNEVLIQYESLLTPKTTFGLNLQTGEKQCLQVAPVS 408          
BLAST of CN185475 vs. ExPASy Swiss-Prot
Match: PTRB_ECOLI (Protease 2 OS=Escherichia coli (strain K12) GN=ptrB PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.376e-12
Identity = 64/218 (29.36%), Postives = 99/218 (45.41%), Query Frame = -1
Query:  126 HKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVY----SIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMG-ISVLKKIETVSY 761
            H +    S D  +Y EKDD Y + L  + SK ++ I   S  T  V  LD    + E  V  PR    + +  H  + F++ R +    N  L    + +  +   LIP RE++ L+   LF D L V ER+ GL       L  +    + + G   + F DP Y    + +P      +  LR+ YSS+ TP ++++ DMD G   VLK+ E   +
Sbjct:  204 HAIGTPASQDKLIYEEKDDTYYVSLHKTTSKHYVVIHLASATTSEVRLLDAEMADAEPFVFLPRRKDHEYSLDHYQHRFYL-RSNRHGKNFGLYRTRMRDEQQWEELIPPRENIMLEGFTLFTDWLVVEERQRGLTS-----LRQINRKTREVIG---IAFDDPAYVTWIAYNPEP---ETARLRYGYSSMTTPDTLFELDMDTGERRVLKQTEVPGF 409          
The following BLAST results are available for this feature:
BLAST of CN185475 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PTRB_MORLA2.538e-1425.82Protease 2 OS=Moraxella lacunata GN=ptrB PE=3 SV=1[more]
PTRB_ECOLI2.376e-1229.36Protease 2 OS=Escherichia coli (strain K12) GN=ptr... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001G09_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185475 ID=CN185475|Name=CN185475|organism=Citrus sinensis|type=EST|length=776bp
GGCCGCCTTTTTTCATGAATACATTTCCTAGTCTATTAAGAGCAGAATGA
CACAAGTCTCTCTTCCAGTGTGTATCGTGTTAGGCTCAAATTTATAGAAC
CACCAAATTGCTAGATTTTTTTAGTATAACTTACAGTTTCAATTTTCTTC
AAAACAGAAATCCCCATGTCCATATCATAATCATATACGGAAGGAGGTGT
CCTCAATGAGCTATAATGAAACCGCAAAATCCTGGATGAAAACACTGATT
CTGATGGATCGATTGAGTATACTGGATCTATAAATTCAACAGACTTGCCA
CCTTGGAGGCTTTTGAGTGGCTCCCCTACAGCTGGAAGACGATAAGTAGT
TATTTTTTGCAGACCCCCTTCACGCTCATACACAGCAAGATGATCAATAA
AAAGTTGTATGTCCTGAAGTTTTACACTTTCTCTGTGTGGAATAAGAACC
GTAGTTTCAGATGTGTTGTCCACAGGACATGCTAGTAGTTCTGAATTGAA
TAACTCATCACTTCTCCTTGTTATGAAGAAATGGTTTCCACGATGACTGG
CTGCTGTATCAACTCCTACTACACGAGGTGTCAAGACCCTCAGCTCTTCA
GGCTTAGAGACATCCAGATAGAAGACAAACCTGGTAATTTTGCTTTCAGA
AGCAATGAATAAAAATTTTTTACTCTCAGAAGCTTGAAGACCAAGAGAAT
ATATATCATCCTTCTCGTGATAAAGGCAGATGTCATTTGACTGGTCTGCT
TCCAACTTATGTAACCCCGCCTTATC
back to top