CN185456

Overview
NameCN185456
Unique NameCN185456
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length833
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185456_ssr197 microsatellite CN185456_ssr197:197..208. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7630 contig Csv1_Contig7630:700..1532. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185456 vs. ExPASy Swiss-Prot
Match: Y1181_ARATH (Uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic OS=Arabidopsis thaliana GN=At1g71810 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 6.598e-27
Identity = 74/136 (54.41%), Postives = 86/136 (63.24%), Query Frame = -2
Query:  425 EFAKGLDALGIATLDYFTSAVIPFAAPFSFSSLTEEDRIXXXXXXXXXXXLSRVQSSKSASVEVKEGSIYKNQTTYSEEASLVFYQLASAQEVLPILSVIPELPPELQQEFLHLPADLAGRLISRAAARTIRRMFL 832
            EFAKGLDA G+ATLD FT     F+     SSLTEED              S +Q +KS   +VK  S Y    T  +EASLV YQL SAQE+LPILS++PELP E QQ  L LP DL GRL++RA ARTIRR+FL
Sbjct:  565 EFAKGLDAYGLATLDSFT-----FSGSGPSSSLTEEDMTNLRTFYRLISLFSGMQKAKS---QVKAVSKYGEALTPLDEASLVMYQLPSAQEMLPILSILPELPQESQQRLLQLPGDLVGRLVTRAFARTIRRIFL 692          
The following BLAST results are available for this feature:
BLAST of CN185456 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1181_ARATH6.598e-2754.41Uncharacterized aarF domain-containing protein kin... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001F19_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001F19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185456 ID=CN185456|Name=CN185456|organism=Citrus sinensis|type=EST|length=833bp
GCTCTGAACAGTGGATCCCCGGGCTGCAGGTTTTTTTTTTTTTCTTAACA
AAGCAAATTCATTGCCTATATTTACCTCTCTTTTCGGTAATGCGATCATC
CAGTGAATTTGTTTTCATTTTTATCAAGGCTGCCAATGTTATACACGCCG
TGAGTAAAAATTTACAGGCCTTTCTTTTTGAATTGTTGTACACATGAAAT
AAATAAATTCAATCAAATGTCTTTTTTATACCATGATTATGGTAAGCTTT
AAGTATCTAACGGCGACCTAAAGAATTGTAATTAAACTGTGGAAAAAATA
GTAAACCTGCAAGTAGATTCATACTGAACACCGCAGATTTATCCTGCTTG
TCACAAGTCCTACTTCAAAGTTATCCTGTGAACATAGTTGATGGAGACAG
ACAGGAAGATGAATAGCCTCCTCATAAGAACATCCTCCTAATGGTCCGAG
CCGCAGCACGGGAAATCAACCTTCCGGCCAGATCAGCAGGCAAGTGAAGA
AACTCCTGTTGCAGTTCTGGTGGGAGCTCAGGAATAACAGAAAGAATGGG
TAAAACCTCTTGTGCTGAAGCAAGTTGATAGAAAACAAGTGACGCTTCTT
CCGAGTACGTTGTTTGATTTTTGTATATGCTACCCTCTTTAACTTCCACA
CTGGCACTTTTGCTACTCTGGACTCTTGACAGTAATAACAAAAGACGACG
CAAATTTGTCAAGTTGATTCTGTCTTCTTCGGTCAGTGAAGAGAATGAAA
AGGGAGCTGCGAAGGGTATCACTGCTGAAGTAAAATAATCTAGGGTTGCT
ATTCCAAGTGCATCCAATCCCTTAGCAAATTCT
back to top