CN185386

Overview
NameCN185386
Unique NameCN185386
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length690
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1300..1989. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 4.069e-111
Identity = 197/226 (87.17%), Postives = 212/226 (93.81%), Query Frame = 3
Query:   12 GKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            GKPFVDVLKEGGVLPGIKVDKGT+E+ GT+ ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGS++ KVTP+VIAE+TVR LQRT+PAAVPAV+FLSGGQSEEEATRNLNAMN+L TKKPWSLSFSFGRALQ STLKAWAGK
Sbjct:   86 GKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSKKVTPEVIAEYTVRTLQRTVPAAVPAVLFLSGGQSEEEATRNLNAMNKLSTKKPWSLSFSFGRALQASTLKAWAGK 311          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 9.064e-111
Identity = 197/228 (86.40%), Postives = 213/228 (93.42%), Query Frame = 3
Query:    6 AAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            AAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENGLVPIVEPEILVDG HDI KCA +TERVLAA YKAL+DHHV+LEGTLLKPNMVTPGS+APKV P+VIAEHTVRALQRT+PAAVPAVVFLSGGQSEEEA+ NLNA+NQ+K KKPW+LSFSFGRALQQSTLKAW GK
Sbjct:   85 AAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITERVLAATYKALSDHHVILEGTLLKPNMVTPGSDAPKVAPEVIAEHTVRALQRTVPAAVPAVVFLSGGQSEEEASVNLNAINQIKGKKPWTLSFSFGRALQQSTLKAWGGK 312          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 1.184e-110
Identity = 195/228 (85.53%), Postives = 212/228 (92.98%), Query Frame = 3
Query:    6 AAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            A GKPFVD +K+GGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENGLVPIVEPEILVDG HDI++CA+V+ERVLAACYKALNDHHVLLEGT LKPN+VTPGSE+ KVTP+VIAE+TVR LQRT+P AVP V+FLSGGQSEEEAT NLNAMN+L+TKKPW+LSFS+GRALQQSTLKAW GK
Sbjct:   84 ADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVLLEGTSLKPNIVTPGSESKKVTPEVIAEYTVRTLQRTVPQAVPGVMFLSGGQSEEEATLNLNAMNKLETKKPWTLSFSYGRALQQSTLKAWQGK 311          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 2.019e-110
Identity = 196/226 (86.73%), Postives = 212/226 (93.81%), Query Frame = 3
Query:   12 GKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            GKPFVDVLKEGGVLPGIKVDKGT+E+AGT  ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGS+A KV+P+VIAE+TVR LQRT+PAAVPA+VFLSGGQSEEEAT NLNAMN+L TKKPWSLSFSFGRALQQSTLKAW+GK
Sbjct:   86 GKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAKKVSPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWSGK 311          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 8.484e-109
Identity = 196/229 (85.59%), Postives = 212/229 (92.58%), Query Frame = 3
Query:    6 AAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            AAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENGLVPIVE EILVDG HDI+KCA +TERVLAA YKAL+DHHVLLEGTLLKPNMVTPGS++PKV P+V+AEHTVRALQRT+PAAVPAVVFLSGGQSEEEAT NLNA+NQ+K KKPW+LSFSFGRALQQSTLKAW+GK
Sbjct:   84 AAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITERVLAATYKALSDHHVLLEGTLLKPNMVTPGSDSPKVAPEVVAEHTVRALQRTVPAAVPAVVFLSGGQSEEEATVNLNAINQVKGKKPWTLSFSFGRALQQSTLKAWSGK 312          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 7.691e-102
Identity = 178/229 (77.73%), Postives = 202/229 (88.21%), Query Frame = 3
Query:    3 AAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            ++ GKPFV++L+E  V+PGIKVDKG VELAGT+GETTTQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENGLV  VEPEIL DG HDI KCA VTE VLAACYKALND HVLLEGTLLKPNMVTPGS++PKV+P+VI E+TV AL+RT+PAAVP +VFLSGGQSEE+AT NLNAMN+    KPW+LSFSFGRALQQSTLK W+GK
Sbjct:   83 SSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTETVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSPKVSPEVIGEYTVNALRRTVPAAVPGIVFLSGGQSEEQATLNLNAMNKFDVVKPWTLSFSFGRALQQSTLKTWSGK 311          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 347.051 bits (889), Expect = 5.339e-95
Identity = 170/226 (75.22%), Postives = 192/226 (84.96%), Query Frame = 3
Query:   12 GKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            GKPFVD+L E GV+PGIKVDKG V+LAGTNGETTTQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENGLVPIVEPE+L  G HDI KCA VTE VLAA +KALN HHVLLEGTLLKPNMVTPGS++PKV P++IAE+TV AL+RT+P A+P +VFLSG Q EE+AT NLNAMN+L   KPW+L+FSFG ALQQS +KAWAGK
Sbjct:   86 GKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVLLEGTLLKPNMVTPGSDSPKVAPELIAEYTVTALRRTVPPAIPGIVFLSGIQREEQATLNLNAMNKLDVLKPWTLTFSFGGALQQSAIKAWAGK 311          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF1_LAMJA (Fructose-bisphosphate aldolase, muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 2.104e-83
Identity = 154/227 (67.84%), Postives = 183/227 (80.62%), Query Frame = 3
Query:   12 GKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVT-PDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            G PFV ++K+ G+L GIKVDKG V LAGTNGE TTQGLDGLA+RC +Y + GA FAKWR VLKI PN PS+L+I ENAN LARYA ICQ+NGLVPIVEPEIL DG HD+  C  +TE+VLAA YKAL+DHHV LEGTLLKPNMVT G+ AP  T P+ +A  T+ AL+RT+P AVP + FLSGGQSEE+A+ +LNA+N+L   KPW+L+FS+GRALQ S LKAW GK
Sbjct:   91 GVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQGLDGLAERCAQYKKDGADFAKWRCVLKISPNTPSRLSIVENANVLARYATICQQNGLVPIVEPEILPDGDHDLKTCQYITEKVLAATYKALSDHHVYLEGTLLKPNMVTVGTAAPASTRPEQVAMATLTALRRTVPPAVPGITFLSGGQSEEDASIHLNAINKLHLIKPWALTFSYGRALQASVLKAWGGK 317          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 6.122e-83
Identity = 153/226 (67.70%), Postives = 183/226 (80.97%), Query Frame = 3
Query:   12 GKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAG 686
            G PFV ++K+ G++ GIKVDKGTV LAGT+GE+TTQGLDGLA+RC +Y + GA FAKWR VLKI  N PS LAI ENAN LARYA ICQ+NGLVPIVEPEIL DG HD+  C  VTE+VLAA YKAL+DHHV LEG+LLKPNMVT G  +  + +P  +A  TV AL+RT+P+AVP + FLSGGQSEE+A+ NLNA+NQL  ++PW+LSFS+GRALQ S LKAWAG
Sbjct:   91 GTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAATYKALSDHHVYLEGSLLKPNMVTAGQASKIRCSPQEVAMATVTALRRTVPSAVPGITFLSGGQSEEDASLNLNAINQLPLERPWALSFSYGRALQASVLKAWAG 316          
BLAST of CN185386 vs. ExPASy Swiss-Prot
Match: ALDOB_CHICK (Fructose-bisphosphate aldolase B OS=Gallus gallus GN=ALDOB PE=3 SV=3)

HSP 1 Score: 306.605 bits (784), Expect = 7.996e-83
Identity = 155/229 (67.69%), Postives = 176/229 (76.86%), Query Frame = 3
Query:    6 AAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGK 689
            ++GKPF  ++KE G++ GIK+D GT  LAGTNGETT QGLD LA+RC +Y + GA F KWRAVLKI    PSQLAI ENAN LARYA ICQ+NGLVPIVEPE+L DG HD+ +C  VTE+VLAA YKALNDHHV LEGTLLKPNMVT G   P K TP  +A  TV  L RT+PAAVP + FLSGGQSEEEA+ NLNAMNQ    KPW L+FS+GRALQ S L AW GK
Sbjct:   89 SSGKPFPAIIKEKGMVVGIKLDAGTAPLAGTNGETTIQGLDKLAERCAQYKKDGADFGKWRAVLKISSTTPSQLAIQENANTLARYASICQQNGLVPIVEPEVLPDGDHDLQRCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHSCPKKYTPQDVAVATVTTLLRTVPAAVPGICFLSGGQSEEEASLNLNAMNQSPLPKPWKLTFSYGRALQASALAAWLGK 317          
The following BLAST results are available for this feature:
BLAST of CN185386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALF_MAIZE4.069e-11187.17Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA9.064e-11186.40Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_SPIOL1.184e-11085.53Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ2.019e-11086.73Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_CICAR8.484e-10985.59Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA7.691e-10277.73Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH5.339e-9575.22Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_LAMJA2.104e-8367.84Fructose-bisphosphate aldolase, muscle type OS=Lam... [more]
ALF2_LAMJA6.122e-8367.70Fructose-bisphosphate aldolase, non-muscle type OS... [more]
ALDOB_CHICK7.996e-8367.69Fructose-bisphosphate aldolase B OS=Gallus gallus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001E04_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185386 ID=CN185386|Name=CN185386|organism=Citrus sinensis|type=EST|length=690bp
AGGCTGCTGCTGGCAAGCCCTTTGTTGATGTCTTGAAGGAGGGTGGAGTC
CTCCCTGGAATTAAGGTTGACAAGGGTACTGTTGAGCTTGCTGGTACCAA
TGGTGAGACCACCACCCAGGGTCTTGATGGCCTCGCCCAGCGCTGCCAGA
AATACTATGAAGCTGGTGCTCGTTTTGCCAAATGGCGTGCTGTTCTTAAG
ATTGGCCCTAATGAGCCTTCGCAGCTGGCCATCAATGAGAATGCCAATGG
CCTGGCCCGATATGCTATCATCTGCCAGGAGAATGGCCTTGTTCCCATTG
TTGAACCTGAGATCCTTGTTGACGGTCCCCATGACATCAACAAGTGTGCT
GATGTGACCGAGCGTGTTCTTGCTGCATGCTACAAGGCTCTGAATGACCA
CCATGTCCTTCTTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTG
GATCTGAAGCTCCCAAAGTTACACCGGACGTGATTGCTGAACACACTGTC
CGGGCCCTGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTT
GTCTGGTGGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGA
ACCAGCTCAAGACGAAGAAGCCATGGTCACTTTCCTTCTCCTTTGGACGT
GCACTTCAGCAGAGCACTCTCAAGGCATGGGCTGGAAAGG
back to top