CN185383

Overview
NameCN185383
Unique NameCN185383
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length823
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185383_ssr441 microsatellite CN185383_ssr441:441..452. BLAST: Citrus ESTs to Prunus persica proteins V1
CN185383_ssr321 microsatellite CN185383_ssr321:321..335. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CN185383 vs. ExPASy Swiss-Prot
Match: PATL1_ARATH (Patellin-1 OS=Arabidopsis thaliana GN=PATL1 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 1.382e-37
Identity = 74/114 (64.91%), Postives = 92/114 (80.70%), Query Frame = -3
Query:  459 RYIAPEQVPVQYGGLSREGEQEFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDVSYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDNQ 800
            +YIAPEQVPV+YGGLS++      T + +TE +VKPA+ YT+E+P +E   L WELRVLG DVSYGA+F P+ EGSY VIVSKTRK+  TDEPVI D+FK+GEPGK+V+TIDNQ
Sbjct:  449 KYIAPEQVPVKYGGLSKDTP---LTEETITEAIVKPAANYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQ 559          
BLAST of CN185383 vs. ExPASy Swiss-Prot
Match: PATL2_ARATH (Patellin-2 OS=Arabidopsis thaliana GN=PATL2 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 7.584e-36
Identity = 77/114 (67.54%), Postives = 88/114 (77.19%), Query Frame = -3
Query:  459 RYIAPEQVPVQYGGLSREGEQEFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDVSYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDNQ 800
            +Y+APE VPV+YGGLS++    FT  D VTE VVK  SKYT+++P TE S L WELRVLG DVSYGA+F PS E SYTVIVSK RKV  TDEPVI D+FK  E GKVV+TIDNQ
Sbjct:  557 KYVAPEVVPVKYGGLSKDSP--FTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNEASYTVIVSKNRKVGLTDEPVITDSFKASEAGKVVITIDNQ 668          
BLAST of CN185383 vs. ExPASy Swiss-Prot
Match: PATL3_ARATH (Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 9.594e-31
Identity = 63/116 (54.31%), Postives = 86/116 (74.14%), Query Frame = -3
Query:  462 RYIAPEQVPVQYGGLSREG---EQEFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDVSYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDN 800
            +YI+PEQVPVQYGGLS +      +F+  D  +E+ VKP +K TVEI + E+  LVWE+RV GW+VSY AEFVP  + +YTV++ K RK+ P+DEPV+  +FK+ E GKV+LT+DN
Sbjct:  358 KYISPEQVPVQYGGLSVDPCDCNPDFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTGWEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDN 473          
BLAST of CN185383 vs. ExPASy Swiss-Prot
Match: PATL5_ARATH (Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 SV=2)

HSP 1 Score: 130.954 bits (328), Expect = 8.122e-30
Identity = 62/116 (53.45%), Postives = 84/116 (72.41%), Query Frame = -3
Query:  462 RYIAPEQVPVQYGGLSREG---EQEFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDVSYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDN 800
            +YI+PE VPVQYGGLS +      +FT  D  TE+ VKP +K TVEI V E+  +VWE+RV+GW+VSYGAEFVP  +  YTVI+ K RK+   +E V+  +FK+GE G+++LT+DN
Sbjct:  533 KYISPEHVPVQYGGLSVDNCECNSDFTHDDIATEITVKPTTKQTVEIIVYEKCTIVWEIRVVGWEVSYGAEFVPENKEGYTVIIQKPRKMTAKNELVVSHSFKVGEVGRILLTVDN 648          
BLAST of CN185383 vs. ExPASy Swiss-Prot
Match: PATL4_ARATH (Patellin-4 OS=Arabidopsis thaliana GN=PATL4 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 6.659e-24
Identity = 56/114 (49.12%), Postives = 79/114 (69.30%), Query Frame = -3
Query:  462 RYIAPEQVPVQYGGLSREGEQEFTTTDPVTEVVVKPASKYTVEIPVTE-RSILVWELRVLGWDVSYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDN 800
            +YI  +++PVQYGG     + EF+  + V+EVVVKP S  T+EIP  E    LVW++ VLGW+V+Y  EFVP+ EG+YTVIV K +K+   + P I ++FK  + GK+VLT+DN
Sbjct:  409 KYIPADELPVQYGGFKTVDDTEFSN-ETVSEVVVKPGSSETIEIPAPETEGTLVWDIAVLGWEVNYKEEFVPTEEGAYTVIVQKVKKMGANEGP-IRNSFKNSQAGKIVLTVDN 520          
BLAST of CN185383 vs. ExPASy Swiss-Prot
Match: PATL6_ARATH (Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.176e-20
Identity = 47/115 (40.87%), Postives = 74/115 (64.35%), Query Frame = -3
Query:  462 HRYIAPEQVPVQYGGLSREGEQEFTTTDPVTEVVVKPASKYTVEIPVTER-SILVWELRVLGWDVSYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDN 803
            +++I PE +PVQYGGLSR  + +     P +E  +K   K  ++I   E  + + W++ V GWD+ Y AEFVP+AE SY ++V K +K+  TDE  +C++F   E GK++L++DN
Sbjct:  274 YKFIRPEDIPVQYGGLSRPTDSQNGPPKPASEFSIKGGEKVNIQIEGIEGGATITWDIVVGGWDLEYSAEFVPNAEESYAIVVEKPKKMKATDE-AVCNSFTTVEAGKLILSVDN 387          
The following BLAST results are available for this feature:
BLAST of CN185383 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PATL1_ARATH1.382e-3764.91Patellin-1 OS=Arabidopsis thaliana GN=PATL1 PE=1 S... [more]
PATL2_ARATH7.584e-3667.54Patellin-2 OS=Arabidopsis thaliana GN=PATL2 PE=1 S... [more]
PATL3_ARATH9.594e-3154.31Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 S... [more]
PATL5_ARATH8.122e-3053.45Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 S... [more]
PATL4_ARATH6.659e-2449.12Patellin-4 OS=Arabidopsis thaliana GN=PATL4 PE=1 S... [more]
PATL6_ARATH1.176e-2040.87Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 S... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001E03_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001E03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185383 ID=CN185383|Name=CN185383|organism=Citrus sinensis|type=EST|length=823bp
TTTTTTTTTTTTTTTTTAGACAGAAAACTTACTAATAATTGGACCGGTAA
AAAAATATATTATAAACCTCCAGCAATTAATAAAGAACACATATACATAA
CAATAATACACCATCAAATTTACACAAATTTTACAGGCAGAGTATATCAA
GATTCAAGAATAACAACAAAGTTTCTGTCCAGATTCCACGCCGTGTCCGG
TCTCCACCCATAGCATCCAACAAAACCAAACCACCAAAAATCCCCAAAAA
CTAATACAAAAAAAATAATATAAATGAAATCCCCCAAAGTTTAAATTTTT
TTATAAAATTAAATTCCAACAAATAAAATAAAATAACCTCTATCATAGAA
ATAAAAGAACCCTTTTCTTATTGTGCAATGCAATGGCCTTCATAGATTGA
TTTAATCAGAGGAGGGCTTGGTCTTGGACCTATATAGGAGCTTCTTCTTC
TTCGAGGACTGGTTATCAATGGTGAGAACCACCTTGCCGGGTTCGCCAAT
TTTGAATGTGTCGCAGATGACCGGTTCATCAGTTGGCGCGACCTTCCTAG
TCTTTGACACTATTACAGTGTAGCTGCCTTCGGCACTAGGCACAAATTCA
GCTCCATAGCTCACATCCCAACCCAAAACTCGGAGTTCCCACACAAGAAT
ACTTCTCTCAGTAACGGGGATTTCAACAGTGTATTTGCTAGCTGGCTTGA
CGACAACCTCAGTAACAGGGTCAGTTGTTGTAAATTCCTGCTCACCCTCC
CTGCTCAATCCACCATACTGAACTGGTACTTGCTCAGGAGCTATGTATCT
GTGTCATCGCCACAATAATAAAA
back to top