CN185249

Overview
NameCN185249
Unique NameCN185249
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length333
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2005 contig Csv1_Contig2005:289..621. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8F_ARATH (Autophagy-related protein 8f OS=Arabidopsis thaliana GN=ATG8F PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.113e-17
Identity = 42/54 (77.78%), Postives = 46/54 (85.19%), Query Frame = -3
Query:  170 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGSHIP 331
            RIKLSAEKAIFIFVDNVLPP GA+ S++YEEKKD+DGFLYVT SG N FG   P
Sbjct:   68 RIKLSAEKAIFIFVDNVLPPAGALMSSVYEEKKDDDGFLYVTYSGENTFGFGSP 121          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8E_ARATH (Autophagy-related protein 8e OS=Arabidopsis thaliana GN=ATG8E PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.372e-17
Identity = 40/51 (78.43%), Postives = 46/51 (90.20%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RIKLSAEKAIFIFVDNVLPPTG + S++YE+KKDEDGFLY+T SG N FG+
Sbjct:   69 RIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFGA 119          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8G_ARATH (Autophagy-related protein 8g OS=Arabidopsis thaliana GN=ATG8G PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.041e-16
Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RI+LSAEKAIFIFVDNVLPPTGA+ S IY+E K+EDGFLYVT SG N FGS
Sbjct:   68 RIQLSAEKAIFIFVDNVLPPTGAMMSTIYDENKEEDGFLYVTYSGENTFGS 118          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_PHANO (Autophagy-related protein 8 OS=Phaeosphaeria nodorum GN=ATG8 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.728e-15
Identity = 40/53 (75.47%), Postives = 43/53 (81.13%), Query Frame = -3
Query:  173 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGSHI 331
            RIKLS EKAIFIFVD VLPPT A+ S+IYEE KDEDGFLY+T SG N FG  I
Sbjct:   67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEAI 119          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8C_ORYSJ (Autophagy-related protein 8C OS=Oryza sativa subsp. japonica GN=ATG8C PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.728e-15
Identity = 40/50 (80.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLSAEKAIFIFV N LPPT A+ SAIYEE KDEDGFLY+T SG N FG
Sbjct:   68 RIKLSAEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8C_ORYSI (Autophagy-related protein 8C OS=Oryza sativa subsp. indica GN=ATG8C PE=3 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 1.728e-15
Identity = 40/50 (80.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLSAEKAIFIFV N LPPT A+ SAIYEE KDEDGFLY+T SG N FG
Sbjct:   68 RIKLSAEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_YARLI (Autophagy-related protein 8 OS=Yarrowia lipolytica GN=ATG8 PE=3 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 2.257e-15
Identity = 39/50 (78.00%), Postives = 44/50 (88.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS+E+AIFIFVD+VLPPT A+ S+IYEE KDEDGFLYVT SG N FG
Sbjct:   67 RIKLSSERAIFIFVDDVLPPTAALMSSIYEEHKDEDGFLYVTYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_CHAGB (Autophagy-related protein 8 OS=Chaetomium globosum GN=ATG8 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.257e-15
Identity = 39/51 (76.47%), Postives = 43/51 (84.31%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RIKLS EKAIFIFVD VLPPT A+ S+IYEE KDEDGFLY+T SG N FG+
Sbjct:   67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGN 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_PODAN (Autophagy-related protein 8 OS=Podospora anserina GN=ATG8 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.948e-15
Identity = 39/50 (78.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFVD VLPPT A+ S+IYEE KDEDGFLY+T SG N FG
Sbjct:   67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_PENCW (Autophagy-related protein 8 OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=atg8 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.948e-15
Identity = 39/50 (78.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFVD VLPPT A+ S+IYEE KDEDGFLY+T SG N FG
Sbjct:   67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFG 116          
The following BLAST results are available for this feature:
BLAST of CN185249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
ATG8F_ARATH4.113e-1777.78Autophagy-related protein 8f OS=Arabidopsis thalia... [more]
ATG8E_ARATH5.372e-1778.43Autophagy-related protein 8e OS=Arabidopsis thalia... [more]
ATG8G_ARATH2.041e-1680.39Autophagy-related protein 8g OS=Arabidopsis thalia... [more]
ATG8_PHANO1.728e-1575.47Autophagy-related protein 8 OS=Phaeosphaeria nodor... [more]
ATG8C_ORYSJ1.728e-1580.00Autophagy-related protein 8C OS=Oryza sativa subsp... [more]
ATG8C_ORYSI1.728e-1580.00Autophagy-related protein 8C OS=Oryza sativa subsp... [more]
ATG8_YARLI2.257e-1578.00Autophagy-related protein 8 OS=Yarrowia lipolytica... [more]
ATG8_CHAGB2.257e-1576.47Autophagy-related protein 8 OS=Chaetomium globosum... [more]
ATG8_PODAN2.948e-1578.00Autophagy-related protein 8 OS=Podospora anserina ... [more]
ATG8_PENCW2.948e-1578.00Autophagy-related protein 8 OS=Penicillium chrysog... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A19_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185249 ID=CN185249|Name=CN185249|organism=Citrus sinensis|type=EST|length=333bp
CTTATATCCAATAGGTAACTGTACATATTATCACTGGCAATGTCTTTATA
AAATATAAAATATGCCCGATAAAGGAATATTCAGCGGAAAGCAAGGATGA
CAATTGAGATAAAAATGCCGTCGCCCCAAAAACCACTCAATGAGCGGATA
GATAATCACAAGGCTAAACTGGGATGTGGCTTCCAAATGGGTTCCCCCCA
CTGGGAGTCACATAAAGAAAACCATCTTCATCCTTTTTCTCTTCGTATAT
GGCAGACCTAATTGCACCGGTAGGTGGGAGCACATTATCCACAAAAATAA
ATATCGCCTTTTCAGCACTCAGTTTGATCCTTT
back to top