CN185244

Overview
NameCN185244
Unique NameCN185244
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length666
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8101 contig Csv1_Contig8101:40..703. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: IN21B_ORYSJ (Protein IN2-1 homolog B OS=Oryza sativa subsp. japonica GN=GSTZ5 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 3.704e-65
Identity = 116/174 (66.67%), Postives = 140/174 (80.46%), Query Frame = 3
Query:  105 FDGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSF--KGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDI 620
            FDGT RLY++Y CP+AQRAWI RNYKGLQDKIK+V ++L DRPAWYKEKVYP NK+P+LEHN +V GESLDL+KY+D+NFEGP+LLPDD EK++FA+EL ++ D F    Y+S   KGD   +A  A D +E AL KF+DGPFFLGQFS VDIAY+PF+ERFQIF S    YDI
Sbjct:   30 FDGTTRLYVAYHCPYAQRAWIARNYKGLQDKIKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSEKQQFAEELLAYTDAFNKASYSSIVAKGDVCDEAVAALDKIEAALSKFNDGPFFLGQFSLVDIAYVPFIERFQIFFSGIKNYDI 203          

HSP 2 Score: 22.3274 bits (46), Expect = 3.704e-65
Identity = 9/15 (60.00%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  622 TAGRPKLAAWIEELN 666
            T GRP L  +IEE+N
Sbjct:  204 TKGRPNLQKFIEEVN 218          
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: IN21B_ORYSI (Protein IN2-1 homolog B OS=Oryza sativa subsp. indica GN=GSTZ5 PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 3.704e-65
Identity = 116/174 (66.67%), Postives = 140/174 (80.46%), Query Frame = 3
Query:  105 FDGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSF--KGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDI 620
            FDGT RLY++Y CP+AQRAWI RNYKGLQDKIK+V ++L DRPAWYKEKVYP NK+P+LEHN +V GESLDL+KY+D+NFEGP+LLPDD EK++FA+EL ++ D F    Y+S   KGD   +A  A D +E AL KF+DGPFFLGQFS VDIAY+PF+ERFQIF S    YDI
Sbjct:   30 FDGTTRLYVAYHCPYAQRAWIARNYKGLQDKIKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSEKQQFAEELLAYTDAFNKASYSSIVAKGDVCDEAVAALDKIEAALSKFNDGPFFLGQFSLVDIAYVPFIERFQIFFSGIKNYDI 203          

HSP 2 Score: 22.3274 bits (46), Expect = 3.704e-65
Identity = 9/15 (60.00%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  622 TAGRPKLAAWIEELN 666
            T GRP L  +IEE+N
Sbjct:  204 TKGRPNLQKFIEEVN 218          
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: IN21A_ORYSJ (Protein IN2-1 homolog A OS=Oryza sativa subsp. japonica GN=Os03g0283200 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.223e-61
Identity = 110/174 (63.22%), Postives = 137/174 (78.74%), Query Frame = 3
Query:  105 FDGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSF--KGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDI 620
            FDGT RLY+ Y CPFAQRAWI RN+KGLQDKI+LV ++LQD+PAWYKEKVY    +P+LEHNGK++GESLDLIKY+DS+FEGP+LLP+DPEKR+FADEL ++ + FT  +Y+    K D + +   A D +E AL KF DGPFFLGQFS VDIAY+  +ER QI+ S   KY+I
Sbjct:   29 FDGTTRLYICYFCPFAQRAWIIRNFKGLQDKIELVGIDLQDKPAWYKEKVYEQGTVPSLEHNGKIMGESLDLIKYIDSHFEGPALLPEDPEKRQFADELIAYANAFTKALYSPLISKADLSAETVAALDKIEAALSKFGDGPFFLGQFSLVDIAYVTIIERIQIYYSHIRKYEI 202          

HSP 2 Score: 22.3274 bits (46), Expect = 5.223e-61
Identity = 9/15 (60.00%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  622 TAGRPKLAAWIEELN 666
            T GRP L  +IEE+N
Sbjct:  203 TNGRPNLEKFIEEIN 217          
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: IN21_MAIZE (Protein IN2-1 OS=Zea mays GN=IN2-1 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 3.850e-55
Identity = 102/174 (58.62%), Postives = 129/174 (74.14%), Query Frame = 3
Query:  105 FDGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSFKGDPA--KQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDI 620
            FDGT RLY+ Y CPFAQRAW+TRN KGLQDK++LV ++LQD+PAWYK+KVY    +P+LEH+ +V GESLDLI+Y+DSNF+GP+LLP+D  KR+FADELF+  + FT  +Y+      A   +   A D LE  L KFDDGPFFLGQFS  D+AY+  +ER QI+ S    YDI
Sbjct:   29 FDGTTRLYICYFCPFAQRAWVTRNLKGLQDKMELVAIDLQDKPAWYKDKVYAQGTVPSLEHDSEVRGESLDLIRYIDSNFDGPALLPEDAAKRQFADELFASANAFTKALYSPLLSHAAVSDEVVAALDKLEADLSKFDDGPFFLGQFSLADVAYVTILERVQIYYSHLRNYDI 202          
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: GSTO1_HUMAN (Glutathione S-transferase omega-1 OS=Homo sapiens GN=GSTO1 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.532e-11
Identity = 50/168 (29.76%), Postives = 86/168 (51.19%), Query Frame = 3
Query:  108 DGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEHN-GKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHIDTFTND-VYTSFKGDPA---KQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQ 587
            +G+ R+Y    CPFA+R  +    KG++ ++  + +NL+++P W+ +K  P   +P LE++ G++I ES    +Y+D  + G  LLPDDP ++   K   ELFS + +     + +  K D A   ++    F  LE+ L       F     S +D    P+ ER +
Sbjct:   21 EGSIRIYSMRFCPFAERTRLVLKAKGIRHEV--ININLKNKPEWFFKK-NPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLE 185          
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: GSTO1_RAT (Glutathione S-transferase omega-1 OS=Rattus norvegicus GN=Gsto1 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.000e-11
Identity = 53/172 (30.81%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  108 DGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEH-NGKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHIDTFTNDVYTSFKGDPAKQAGPAF-DYLEKALDKFDDG------PFFLG-QFSQVDIAYIPFVERFQ 587
            +G  R+Y    CPFAQR  +    KG++ +I  + +NL+++P W+ EK  P   +P LE+  G +I ES+   +Y+D  +    L PDDP ++   K   ELFS + +    + TSF     K+  P   + L+K   K ++        FF G   S +D    P+ +R +
Sbjct:   21 EGQIRVYSMRFCPFAQRTLMVLKAKGIRHEI--ININLKNKPEWFFEK-NPFGLVPVLENTQGHLITESVITCEYLDEAYPEKKLFPDDPYEKACQKMTFELFSKVPS----LVTSFIRAKRKEDHPGIKEELKKEFSKLEEAMANKRTAFFGGNSLSMIDYLIWPWFQRLE 185          
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: GSTO1_PIG (Glutathione S-transferase omega-1 OS=Sus scrofa GN=GSTO1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.412e-11
Identity = 50/168 (29.76%), Postives = 82/168 (48.81%), Query Frame = 3
Query:  108 DGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEHN-GKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHID----TFTNDVYTSFKGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQ 587
            +G  R+Y    CPFAQR  +  N KG++ ++  + +NL+++P W+ +K  P   +P LE++ G++I ES    +Y+D  + G  LLPDDP ++   K   EL S +      F      +      ++    F  LE+ L K     F     S +D    P+ ER +
Sbjct:   21 EGLIRVYSMRFCPFAQRTLLVLNAKGIRHQV--ININLKNKPEWFFQK-NPSGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELSSKVPPLLIRFIRRENEADCSGLKEELRKEFSKLEEVLTKKKTTYFGGSSLSMIDYLIWPWFERLE 185          
BLAST of CN185244 vs. ExPASy Swiss-Prot
Match: GSTO1_MOUSE (Glutathione S-transferase omega-1 OS=Mus musculus GN=Gsto1 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11
Identity = 52/171 (30.41%), Postives = 85/171 (49.71%), Query Frame = 3
Query:  108 DGTPRLYMSYSCPFAQRAWITRNYKGLQDKIKLVPLNLQDRPAWYKEKVYPVNKIPALEHN-GKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHIDTFTNDVYTSFKGDPAKQAGPAF-DYLEKALDKFDDG----PFFLG--QFSQVDIAYIPFVERFQ 587
            +G  R+Y    CPFAQR  +    KG++ ++  + +NL+++P W+ EK  P+  +P LE++ G ++ ES+   +Y+D  +    L PDDP K+   K   E FS +      +  SF     K+  P   + LE    K ++G      FLG    S VD    P+ +R +
Sbjct:   21 EGQIRVYSMRFCPFAQRTLMVLKAKGIRHEV--ININLKNKPEWFFEK-NPLGLVPVLENSQGHLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESFSKVP----PLIASFVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLE 184          
The following BLAST results are available for this feature:
BLAST of CN185244 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
IN21B_ORYSJ3.704e-6566.67Protein IN2-1 homolog B OS=Oryza sativa subsp. jap... [more]
IN21B_ORYSI3.704e-6566.67Protein IN2-1 homolog B OS=Oryza sativa subsp. ind... [more]
IN21A_ORYSJ5.223e-6163.22Protein IN2-1 homolog A OS=Oryza sativa subsp. jap... [more]
IN21_MAIZE3.850e-5558.62Protein IN2-1 OS=Zea mays GN=IN2-1 PE=2 SV=1[more]
GSTO1_HUMAN1.532e-1129.76Glutathione S-transferase omega-1 OS=Homo sapiens ... [more]
GSTO1_RAT2.000e-1130.81Glutathione S-transferase omega-1 OS=Rattus norveg... [more]
GSTO1_PIG3.412e-1129.76Glutathione S-transferase omega-1 OS=Sus scrofa GN... [more]
GSTO1_MOUSE7.602e-1130.41Glutathione S-transferase omega-1 OS=Mus musculus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A16_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185244 ID=CN185244|Name=CN185244|organism=Citrus sinensis|type=EST|length=666bp
AAAGCTTTTAGGAAACCTCTAGAGTCTTACCTTCCTCCCCCTTAACCACC
CCCCAAGAGAATCTTCCTCCACCGTTGGATCCTAAGGCCGAGCTACCACC
TCTGTTCGATGGAACTCCCAGGTTGTACATGTCTTACTCGTGCCCATTTG
CTCAGCGTGCGTGGATCACCAGGAACTACAAGGGATTACAAGACAAGATT
AAGTTAGTTCCACTGAACCTCCAAGATAGGCCCGCTTGGTACAAGGAGAA
GGTTTATCCTGTTAACAAGATTCCAGCACTGGAGCACAATGGCAAAGTTA
TTGGAGAATCTCTTGATTTGATTAAATATGTTGACAGCAATTTTGAAGGG
CCTTCACTTTTACCTGATGATCCTGAGAAACGAAAGTTTGCTGATGAACT
GTTTTCCCACATCGATACCTTCACCAACGATGTGTATACTTCATTCAAAG
GAGACCCAGCAAAACAAGCTGGTCCTGCTTTTGATTACTTAGAGAAGGCC
CTTGATAAATTTGATGATGGCCCGTTCTTCCTTGGACAGTTCAGTCAGGT
GGACATAGCCTATATTCCATTTGTTGAGAGATTCCAGATCTTCTTATCAG
AAGAATTTAAGTATGACATTCACTGCAGGCAGGCCTAAACTGGCAGCATG
GATTGAGGAGTTGAAC
back to top