CN184833
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT2_POPTR (Caffeoyl-CoA O-methyltransferase 2 OS=Populus trichocarpa GN=CCOAOMT2 PE=2 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 1.666e-17 Identity = 40/42 (95.24%), Postives = 42/42 (100.00%), Query Frame = -1 Query: 321 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRIK 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+T+CRRIK Sbjct: 206 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIK 247
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT_MEDSA (Caffeoyl-CoA O-methyltransferase OS=Medicago sativa GN=CCOMT PE=1 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 2.841e-17 Identity = 40/42 (95.24%), Postives = 41/42 (97.62%), Query Frame = -1 Query: 321 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRIK 446 RKYVRYYRDFVLELNKALA DPRIEICMLPVGDG+TICRRIK Sbjct: 206 RKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRIK 247
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT4_ARATH (Probable caffeoyl-CoA O-methyltransferase At4g34050 OS=Arabidopsis thaliana GN=At4g34050 PE=2 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 3.711e-17 Identity = 40/41 (97.56%), Postives = 41/41 (100.00%), Query Frame = -1 Query: 324 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRI 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+TICRRI Sbjct: 218 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRI 258
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT_POPTM (Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 4.847e-17 Identity = 39/42 (92.86%), Postives = 42/42 (100.00%), Query Frame = -1 Query: 321 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRIK 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+T+CRRI+ Sbjct: 206 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ 247
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT_EUCGU (Caffeoyl-CoA O-methyltransferase OS=Eucalyptus gunnii PE=2 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 4.847e-17 Identity = 39/42 (92.86%), Postives = 42/42 (100.00%), Query Frame = -1 Query: 321 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRIK 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+T+CRRI+ Sbjct: 205 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ 246
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT1_POPTR (Caffeoyl-CoA O-methyltransferase 1 OS=Populus trichocarpa GN=CCOAOMT1 PE=2 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 4.847e-17 Identity = 39/42 (92.86%), Postives = 42/42 (100.00%), Query Frame = -1 Query: 321 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRIK 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+T+CRRI+ Sbjct: 206 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ 247
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT6_TOBAC (Caffeoyl-CoA O-methyltransferase 6 OS=Nicotiana tabacum GN=CCOAOMT6 PE=2 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 6.330e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = -1 Query: 324 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRI 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+T+CRRI Sbjct: 206 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 246
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT5_TOBAC (Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 6.330e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = -1 Query: 324 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRI 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+T+CRRI Sbjct: 199 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 239
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT1_EUCGL (Caffeoyl-CoA O-methyltransferase 1 OS=Eucalyptus globulus GN=CCOMT PE=2 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 6.330e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = -1 Query: 324 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRI 446 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDG+T+CRRI Sbjct: 205 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 245
BLAST of CN184833 vs. ExPASy Swiss-Prot
Match: CAMT_PETCR (Caffeoyl-CoA O-methyltransferase OS=Petroselinum crispum PE=1 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 8.267e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = -1 Query: 324 RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRI 446 RKYVRYYRDFV+ELNKALAADPRIEICMLPVGDGVT+CRRI Sbjct: 200 RKYVRYYRDFVIELNKALAADPRIEICMLPVGDGVTLCRRI 240 The following BLAST results are available for this feature:
BLAST of CN184833 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN184833 ID=CN184833; Name=CN184833; organism=Citrus sinensis; type=EST; length=446bpback to top |