CN184608
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN184608 vs. ExPASy Swiss-Prot
Match: ADK1_ARATH (Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.562e-14 Identity = 35/49 (71.43%), Postives = 39/49 (79.59%), Query Frame = -1 Query: 42 VDPNGAGEPFVGGFLSQ*VHEKPVEDCVRAGCYAANVVIQRSALHLPPK 188 VD NGAG+ FVGGFLSQ VH K +E+CVRAGCYA+NVVIQRS P K Sbjct: 292 VDTNGAGDAFVGGFLSQLVHGKGIEECVRAGCYASNVVIQRSGCTYPEK 340 HSP 2 Score: 22.7126 bits (47), Expect = 5.562e-14 Identity = 7/9 (77.78%), Postives = 8/9 (88.89%), Query Frame = -2 Query: 32 CTYPPKPEF 58 CTYP KP+F Sbjct: 335 CTYPEKPDF 343
BLAST of CN184608 vs. ExPASy Swiss-Prot
Match: ADK2_ARATH (Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.672e-13 Identity = 33/49 (67.35%), Postives = 39/49 (79.59%), Query Frame = -1 Query: 42 VDPNGAGEPFVGGFLSQ*VHEKPVEDCVRAGCYAANVVIQRSALHLPPK 188 VD NGAG+ FVGGF+SQ V EK +E+CV+AGCYA+NVVIQRS P K Sbjct: 293 VDTNGAGDAFVGGFMSQLVKEKSIEECVKAGCYASNVVIQRSGCTYPEK 341 HSP 2 Score: 22.7126 bits (47), Expect = 2.672e-13 Identity = 7/9 (77.78%), Postives = 8/9 (88.89%), Query Frame = -2 Query: 32 CTYPPKPEF 58 CTYP KP+F Sbjct: 336 CTYPEKPDF 344 The following BLAST results are available for this feature:
BLAST of CN184608 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN184608 ID=CN184608; Name=CN184608; organism=Citrus sinensis; type=EST; length=188bpback to top |