CN184571
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN184571 vs. ExPASy Swiss-Prot
Match: ENO_RICCO (Enolase OS=Ricinus communis PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.107e-11 Identity = 32/34 (94.12%), Postives = 33/34 (97.06%), Query Frame = -2 Query: 229 KRLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 330 +RLAKYNQLLRIEEELGAEAVYAGAKFR PVEPY Sbjct: 412 ERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY 445 HSP 2 Score: 20.7866 bits (42), Expect = 2.107e-11 Identity = 8/11 (72.73%), Postives = 8/11 (72.73%), Query Frame = -1 Query: 317 GAPCRSEASCK 349 GAPCRSE K Sbjct: 406 GAPCRSERLAK 416
BLAST of CN184571 vs. ExPASy Swiss-Prot
Match: ENO_ORYSJ (Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 3.550e-11 Identity = 32/34 (94.12%), Postives = 33/34 (97.06%), Query Frame = -2 Query: 229 KRLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 330 +RLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY Sbjct: 413 ERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY 446 HSP 2 Score: 20.7866 bits (42), Expect = 3.550e-11 Identity = 8/11 (72.73%), Postives = 8/11 (72.73%), Query Frame = -1 Query: 317 GAPCRSEASCK 349 GAPCRSE K Sbjct: 407 GAPCRSERLAK 417
BLAST of CN184571 vs. ExPASy Swiss-Prot
Match: ENO2_MAIZE (Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 5.980e-11 Identity = 32/34 (94.12%), Postives = 33/34 (97.06%), Query Frame = -2 Query: 229 KRLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 330 +RLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY Sbjct: 413 ERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY 446 HSP 2 Score: 20.7866 bits (42), Expect = 5.980e-11 Identity = 8/11 (72.73%), Postives = 8/11 (72.73%), Query Frame = -1 Query: 317 GAPCRSEASCK 349 GAPCRSE K Sbjct: 407 GAPCRSERLAK 417
BLAST of CN184571 vs. ExPASy Swiss-Prot
Match: ENO2_HEVBR (Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 7.764e-11 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = -2 Query: 229 KRLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 330 +RLAKYNQLLRIEEELGAEAVYAGA FR PVEPY Sbjct: 412 ERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY 445 HSP 2 Score: 20.7866 bits (42), Expect = 7.764e-11 Identity = 8/11 (72.73%), Postives = 8/11 (72.73%), Query Frame = -1 Query: 317 GAPCRSEASCK 349 GAPCRSE K Sbjct: 406 GAPCRSERLAK 416 The following BLAST results are available for this feature:
BLAST of CN184571 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN184571 ID=CN184571; Name=CN184571; organism=Citrus sinensis; type=EST; length=349bpback to top |