CN184459
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN184459 vs. ExPASy Swiss-Prot
Match: AS1_ARATH (Transcription factor AS1 OS=Arabidopsis thaliana GN=AS1 PE=1 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 7.393e-22 Identity = 37/54 (68.52%), Postives = 49/54 (90.74%), Query Frame = -1 Query: 255 DEQRATLDRIEAEYREQIAGLRRDAEAKEQKLAEQWSAKHLRLTKFLE-QMGCR 413 +EQ+ +++IE EYREQ+ GLRRDAEAK+QKLA+QW+++H+RLTKFLE QMGCR Sbjct: 310 EEQKNAMEKIEGEYREQLVGLRRDAEAKDQKLADQWTSRHIRLTKFLEQQMGCR 363 HSP 2 Score: 41.2022 bits (95), Expect = 7.393e-22 Identity = 18/20 (90.00%), Postives = 19/20 (95.00%), Query Frame = -3 Query: 466 KEAAWRLRRVELQLESEKAC 525 KEAAWRLRR+ELQLESEK C Sbjct: 273 KEAAWRLRRLELQLESEKTC 292
BLAST of CN184459 vs. ExPASy Swiss-Prot
Match: RS2_ORYSJ (Protein rough sheath 2 homolog OS=Oryza sativa subsp. japonica GN=RS2 PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 1.028e-20 Identity = 38/54 (70.37%), Postives = 48/54 (88.89%), Query Frame = -1 Query: 255 DEQRATLDRIEAEYREQIAGLRRDAEAKEQKLAEQWSAKHLRLTKFLEQM-GCR 413 +EQ A ++R+EAEYRE++AGLRRDAEAKEQK+AEQW+AKH RL KFL+Q+ CR Sbjct: 270 EEQAAAVERVEAEYREKMAGLRRDAEAKEQKMAEQWAAKHARLAKFLDQVAACR 323 HSP 2 Score: 38.891 bits (89), Expect = 1.028e-20 Identity = 15/20 (75.00%), Postives = 20/20 (100.00%), Query Frame = -3 Query: 466 KEAAWRLRRVELQLESEKAC 525 KEAAWR++RVE+QLE+E+AC Sbjct: 233 KEAAWRMKRVEMQLETERAC 252
BLAST of CN184459 vs. ExPASy Swiss-Prot
Match: RS2_MAIZE (Protein rough sheath 2 OS=Zea mays GN=RS2 PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 3.044e-15 Identity = 30/50 (60.00%), Postives = 42/50 (84.00%), Query Frame = -1 Query: 261 EQRATLDRIEAEYREQIAGLRRDAEAKEQKLAEQWSAKHLRLTKFLEQMG 410 EQ A +R+E ++RE++A LRRDA+ KE+K+AEQW+AKH R+ KF+EQMG Sbjct: 307 EQAAAAERVERDHREKVAELRRDAQVKEEKMAEQWAAKHARVAKFVEQMG 356 HSP 2 Score: 31.187 bits (69), Expect = 3.044e-15 Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = -3 Query: 472 KEAAWRLRRVELQLESEK 525 +EAAWRL+RVE QLE E+ Sbjct: 269 REAAWRLKRVEQQLEMER 286 The following BLAST results are available for this feature:
BLAST of CN184459 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN184459 ID=CN184459; Name=CN184459; organism=Citrus sinensis; type=EST; length=527bpback to top |