CN189181
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN189181 vs. ExPASy Swiss-Prot
Match: UBR7_HUMAN (Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens GN=UBR7 PE=1 SV=2) HSP 1 Score: 84.3445 bits (207), Expect = 3.887e-16 Identity = 38/79 (48.10%), Postives = 54/79 (68.35%), Query Frame = 2 Query: 86 EAEQTISINEYLNDVEEKELEADLVLGGDEGKECTYSKGYMKRQAIFSCLTCAPEGN--AGVCTACSLTCHDGHEVFSL 316 E E +S+ + L + EE E EA VLGG + ++C+YS+G +KRQA+++C TC PEG AG+C ACS CH H++F L Sbjct: 13 ELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEEPAGICLACSYECHGSHKLFEL 91
BLAST of CN189181 vs. ExPASy Swiss-Prot
Match: UBR7_MOUSE (Putative E3 ubiquitin-protein ligase UBR7 OS=Mus musculus GN=Ubr7 PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 2.520e-15 Identity = 37/79 (46.84%), Postives = 53/79 (67.09%), Query Frame = 2 Query: 86 EAEQTISINEYLNDVEEKELEADLVLGGDEGKECTYSKGYMKRQAIFSCLTCAPEGN--AGVCTACSLTCHDGHEVFSL 316 E E +S+ + L + EE E EA VLGG + ++C+YS+G + RQA+++C TC PEG AG+C ACS CH H++F L Sbjct: 13 ELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVGRQALYACSTCTPEGEEPAGICLACSYECHGSHKLFEL 91 The following BLAST results are available for this feature:
BLAST of CN189181 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN189181 ID=CN189181; Name=CN189181; organism=Citrus sinensis; type=EST; length=540bpback to top |