CN189136

Overview
NameCN189136
Unique NameCN189136
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length681
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1278 contig Csv1_Contig1278:24..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24_PRUAV (60S ribosomal protein L24 OS=Prunus avium GN=RPL24 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.346e-57
Identity = 108/112 (96.43%), Postives = 110/112 (98.21%), Query Frame = 1
Query:   19 MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            MVLKTELC+FSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIA EAVKK+RR TKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL
Sbjct:    1 MVLKTELCRFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112          

HSP 2 Score: 23.8682 bits (50), Expect = 1.346e-57
Identity = 7/18 (38.89%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  462 GCRPEGPQARRWWWKAVN 515
            G +P+GP+   W W+A++
Sbjct:  149 GAQPKGPKLGGWRWQALS 166          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24_CICAR (60S ribosomal protein L24 OS=Cicer arietinum GN=RPL24 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.634e-54
Identity = 103/112 (91.96%), Postives = 108/112 (96.43%), Query Frame = 1
Query:   19 MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            MVLKTELC+FSGAKIYPG+GIRFIR DSQVFLF NSKCKRYFHNRLKPSKLTWTAM+RKQHKKD A EAVKK+RRATKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAAL
Sbjct:    1 MVLKTELCRFSGAKIYPGRGIRFIRGDSQVFLFVNSKCKRYFHNRLKPSKLTWTAMFRKQHKKDAAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAAL 112          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24_HORVU (60S ribosomal protein L24 OS=Hordeum vulgare GN=RPL24 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.230e-53
Identity = 102/112 (91.07%), Postives = 106/112 (94.64%), Query Frame = 1
Query:   19 MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            MVLKTELC+FSG KIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKP+KL WTAMYRKQHKKDI AEA KK+RR TKKPYSRSIVGATLEVIQK+R EKPEVRDAAREAAL
Sbjct:    1 MVLKTELCRFSGQKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPAKLCWTAMYRKQHKKDIHAEAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAAL 112          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL242_ARATH (60S ribosomal protein L24-2 OS=Arabidopsis thaliana GN=RPL24B PE=2 SV=2)

HSP 1 Score: 206.453 bits (524), Expect = 1.107e-52
Identity = 100/112 (89.29%), Postives = 106/112 (94.64%), Query Frame = 1
Query:   19 MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            MVLKTELC+FSG KIYPG+GIRFIRSDSQVFLF NSKCKRYFHN+LKPSKL WTAMYRKQHKKD A EAVK++RRATKKPYSRSIVGATLEVIQK+R EKPEVRDAAREAAL
Sbjct:    1 MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLAWTAMYRKQHKKDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAAL 112          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL241_ARATH (60S ribosomal protein L24-1 OS=Arabidopsis thaliana GN=RPL24A PE=1 SV=2)

HSP 1 Score: 206.068 bits (523), Expect = 1.445e-52
Identity = 100/112 (89.29%), Postives = 106/112 (94.64%), Query Frame = 1
Query:   19 MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            MVLKTELC+FSG KIYPG+GIRFIRSDSQVFLF NSKCKRYFHN+LKPSKL WTAMYRKQHKKD A EAVK++RRATKKPYSRSIVGATLEVIQK+R EKPEVRDAAREAAL
Sbjct:    1 MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLCWTAMYRKQHKKDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAAL 112          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24B_SCHPO (60S ribosomal protein L24-B OS=Schizosaccharomyces pombe GN=rpl24b PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.761e-26
Identity = 56/110 (50.91%), Postives = 77/110 (70.00%), Query Frame = 1
Query:   25 LKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            +K E+C FSG+K+YPG G  F+R D++VF F N K +  F  R  P +L+WT +YR+ HKK I+ E  KK+ R T K + R IVGA L+VI+++R ++PEVR AAR AAL
Sbjct:    1 MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHKKGISEEHAKKRTRRTVK-HQRGIVGANLDVIKEKRNQRPEVRAAARAAAL 109          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24A_SCHPO (60S ribosomal protein L24-A OS=Schizosaccharomyces pombe GN=rpl24a PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.761e-26
Identity = 56/110 (50.91%), Postives = 77/110 (70.00%), Query Frame = 1
Query:   25 LKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            +K E+C FSG+K+YPG G  F+R D++VF F N K +  F  R  P +L+WT +YR+ HKK I+ E  KK+ R T K + R IVGA L+VI+++R ++PEVR AAR AAL
Sbjct:    1 MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHKKGISEEHAKKRTRRTVK-HQRGIVGANLDVIKEKRNQRPEVRAAARAAAL 109          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24_DEBHA (60S ribosomal protein L24 OS=Debaryomyces hansenii GN=RPL24 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.967e-25
Identity = 55/110 (50.00%), Postives = 78/110 (70.91%), Query Frame = 1
Query:   25 LKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 354
            +K EL  FSG KIYPG+G  F+R DS++F F +SK    FH R  P +++WT +YR+QHKK I+ E+ K++ R T K   R+IVGA+LE+I++RR++KP  R AAR+  L
Sbjct:    1 MKVELDSFSGTKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRISWTVLYRRQHKKGISEESAKRRTRKTVK-NQRAIVGASLELIKERRSQKPSDRKAARDVKL 109          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24_ASHGO (60S ribosomal protein L24 OS=Ashbya gossypii GN=RPL24 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.476e-25
Identity = 54/107 (50.47%), Postives = 74/107 (69.16%), Query Frame = 1
Query:   25 LKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAARE 345
            +K E+  FSGAKIYPG+G  F+R DS+VF F +SK    FH R  P ++ WT +YR+ HKK I  E  KK+ R T K   R++VGA+LE+I++RR+ KPE+R A R+
Sbjct:    1 MKVEIDSFSGAKIYPGRGTLFVRGDSKVFRFHSSKSASLFHQRKNPRRIAWTVLYRRHHKKGITEEVAKKRSRKTVKA-QRAVVGASLELIKERRSLKPEIRKAKRD 106          
BLAST of CN189136 vs. ExPASy Swiss-Prot
Match: RL24_CANGA (60S ribosomal protein L24 OS=Candida glabrata GN=RPL24 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.665e-24
Identity = 55/107 (51.40%), Postives = 73/107 (68.22%), Query Frame = 1
Query:   25 LKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAARE 345
            +K E+  FSGAKIYPG+G  F+R DS++F F NSK    F  R  P ++ WT +YR+ HKK I  E  KK+ R T K   R+IVGA+LE+I++RR+ KPEVR A R+
Sbjct:    1 MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRVAWTVLYRRHHKKGITEEVAKKRSRKTVKA-QRAIVGASLELIKERRSLKPEVRKAKRD 106          
The following BLAST results are available for this feature:
BLAST of CN189136 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
RL24_PRUAV1.346e-5796.4360S ribosomal protein L24 OS=Prunus avium GN=RPL24... [more]
RL24_CICAR2.634e-5491.9660S ribosomal protein L24 OS=Cicer arietinum GN=RP... [more]
RL24_HORVU2.230e-5391.0760S ribosomal protein L24 OS=Hordeum vulgare GN=RP... [more]
RL242_ARATH1.107e-5289.2960S ribosomal protein L24-2 OS=Arabidopsis thalian... [more]
RL241_ARATH1.445e-5289.2960S ribosomal protein L24-1 OS=Arabidopsis thalian... [more]
RL24B_SCHPO6.761e-2650.9160S ribosomal protein L24-B OS=Schizosaccharomyces... [more]
RL24A_SCHPO6.761e-2650.9160S ribosomal protein L24-A OS=Schizosaccharomyces... [more]
RL24_DEBHA1.967e-2550.0060S ribosomal protein L24 OS=Debaryomyces hansenii... [more]
RL24_ASHGO7.476e-2550.4760S ribosomal protein L24 OS=Ashbya gossypii GN=RP... [more]
RL24_CANGA1.665e-2451.4060S ribosomal protein L24 OS=Candida glabrata GN=R... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001G01_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001G01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189136 ID=CN189136|Name=CN189136|organism=Citrus sinensis|type=EST|length=681bp
GACCCTTCATCAGAAACCATGGTTCTCAAGACTGAACTTTGCAAATTCAG
CGGTGCCAAGATATACCCTGGTAAGGGTATCAGATTTATTCGTTCAGACT
CTCAGGTTTTCCTCTTTGCCAATTCTAAATGCAAGAGGTACTTCCACAAC
CGATTGAAGCCATCGAAGCTTACATGGACAGCCATGTACAGGAAACAGCA
CAAGAAGGACATTGCTGCTGAGGCAGTTAAGAAGAAGCGTCGTGCCACTA
AGAAGCCCTATTCAAGATCTATAGTTGGTGCCACCTTGGAAGTTATCCAG
AAGAGAAGAACTGAGAAGCCAGAAGTCCGAGATGCTGCACGGGAGGCTGC
ACTTCGTGAAATTAAGGAGAGGATCAAGAAGACTAAGGATGAAAAGAAGG
CAAAGAAAGCGGAGACGATGTCCAAGTCACAGAAGTCTCAAGTCAAAAGT
AGCGTGCCTAAGGGTGCCGCCCCGAAGGGCCCCAAGCTAGGCGGTGGTGG
TGGAAAGCGGTGAATTGCTTAGTCTTTTCAAATCTGCAGATGAGTATAAA
CAATTAGAACTTAATTTCATGTTTCTTGTATGGATTGATCAATCATGTAG
ACCAGATTTTTTTGTGGTTTTTGTTTATGGTTTTGCATTGNGAGTTAATT
TGCCTTTTACTTAATTGAATCAAAGTTTTCT
back to top