CN189120

Overview
NameCN189120
Unique NameCN189120
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6120 contig Csv1_Contig6120:949..1678. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C98A2_SOYBN (Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.110e-109
Identity = 182/238 (76.47%), Postives = 207/238 (86.97%), Query Frame = 1
Query:    7 KGGGAAKPHFVDALLNLQEEYELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVVATPRLADH 720
            K  G AK HFVDALL LQ++Y+LS+DTIIGLLW+MI AGMDTT I+VEWAMAELI+NPRVQQK QEELD+V+G  RVMTEADF NL YLQCV KE+MRLHPPTPLMLPH+ANA+VK+ GY++PKGS VHVNVWA+ RDPA WK+PLEFRPERFLEED+DMKGHD+RLLPFGSGRR+CPG QLGINL  SMLGHLLHHF W P +G+KPEEIDM  NPG VTYM TP++ V +PRL  H
Sbjct:  263 KKSGGAKQHFVDALLTLQDKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIRNPRVQQKVQEELDRVIGLERVMTEADFSNLPYLQCVTKEAMRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAVWKDPLEFRPERFLEEDVDMKGHDFRLLPFGSGRRVCPGAQLGINLAASMLGHLLHHFCWTPPEGMKPEEIDMGENPGLVTYMRTPIQAVVSPRLPSH 500          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C98A3_ARATH (Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 2.314e-107
Identity = 178/230 (77.39%), Postives = 203/230 (88.26%), Query Frame = 1
Query:   22 AKPHFVDALLNLQEEYELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVVATPRL 711
            AK HFVDALL L+++Y+LS+DTIIGLLW+MI AGMDTT IT EWAMAE+IKNPRVQQK QEE D+VVG +R++TEADF  L YLQCVVKES RLHPPTPLMLPH++NADVKI GY++PKGS VHVNVWA+ RDPA WKNP EFRPERFLEED+DMKGHD+RLLPFG+GRR+CPG QLGINLVTSM+ HLLHHF W P +G KPEEIDM+ NPG VTYM TP++ VATPRL
Sbjct:  267 AKQHFVDALLTLKDQYDLSEDTIIGLLWDMITAGMDTTAITAEWAMAEMIKNPRVQQKVQEEFDRVVGLDRILTEADFSRLPYLQCVVKESFRLHPPTPLMLPHRSNADVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPFEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMMSHLLHHFVWTPPQGTKPEEIDMSENPGLVTYMRTPVQAVATPRL 496          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 2.835e-97
Identity = 163/236 (69.07%), Postives = 200/236 (84.75%), Query Frame = 1
Query:   22 AKPHFVDALLNLQEEYELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVVATPRLADHGLY 729
            AK HFVDAL  L+++Y+LS+DT+IGLLW+MI AGMDTT I+VEWAMAEL++NPRVQ+K QEELD+VVG +RVM E DFQNL YLQ VVKES+RLHPPTPLMLPHKA+ +VKI GY++PKG+ V VNVWA+ RDP  W NPLE+RPERFLEE+ID+KG D+R+LPFG+GRR+CPG QLGINLV SM+GHLLHHF W+  +G +PE+++M  +PG VT+M TPL+ VA PRL    LY
Sbjct:  270 AKQHFVDALFTLKQQYDLSEDTVIGLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMLETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDPKVWSNPLEYRPERFLEENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHHFEWSLPEGTRPEDVNMMESPGLVTFMGTPLQAVAKPRLEKEELY 505          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.797e-59
Identity = 114/223 (51.12%), Postives = 152/223 (68.16%), Query Frame = 1
Query:   34 FVDALLNLQE--EYELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVV 696
            F+D+LL L E  E EL ++ I  LL +M  AG DT++ T+EWAMAEL++NP+   KAQ E+D+V+G N V+ E+D   L YLQ VVKE+ RLHP  PL++P KA +DV++ G+ VPK + V VNVWAIGRDP+ W+NP +F PERF+ +DID+KG DY L PFG GRRICPG+ L +  V+ ML  LL+ F W    GV  E++DM    G   + T  L  +
Sbjct:  281 FLDSLLILNEGDEAELDNNDIEHLLLDMFTAGTDTSSSTLEWAMAELLRNPKTMVKAQAEMDRVLGQNSVVQESDISGLPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVLVNVWAIGRDPSVWENPSQFEPERFMGKDIDVKGRDYELTPFGGGRRICPGLPLAVKTVSLMLASLLYSFDWKLPNGVVSEDLDMDETFGITLHRTNTLYAI 503          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 5.228e-59
Identity = 116/233 (49.79%), Postives = 154/233 (66.09%), Query Frame = 1
Query:   22 AKPHFVDALLNLQ-EEYELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVVATPRLAD 717
            +K  FVD LL+ + +E ELS   I  LL +M  AG DT++ T+EWAM EL+KNP+   KAQ E+D V+G N ++ E+D   L YLQ VVKE+ RLH P PL++P KA +D +I G+ V K + V VNVWAIGRDP+ W NP +F PERFL +D+D++G DY L PFG+GRRICPG+ L +  V+ ML  LL+ F W   KGV  E++DM    G   + T PL  V   + A+
Sbjct:  278 SKNDFVDNLLDYKGDESELSISDIEHLLLDMFTAGTDTSSSTLEWAMTELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEILGFMVLKDTQVLVNVWAIGRDPSVWDNPSQFEPERFLGKDMDVRGRDYELTPFGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETFGLTLHKTNPLHAVPVKKRAN 510          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.827e-59
Identity = 115/223 (51.57%), Postives = 148/223 (66.37%), Query Frame = 1
Query:   34 FVDALLNLQE--EYELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVV 696
            FVD LL+L E  E EL+ + I+ LL ++  AG DT + TVEWAMAEL++NP    KAQ E+D V+G   V+ E+D   L YLQ VVKE+ RLHP  PL++P KA +DV++ G+ VPK + V VNVWAIGRDP  W+N   F+PERFL +DID++G DY L PFG+GRRICPG+ L +  V  ML  LL+ F W    GV  E++DM    G   + T PL  V
Sbjct:  282 FVDVLLDLTEGDEAELNTNDIVHLLLDLFGAGTDTNSSTVEWAMAELLRNPETMVKAQAEIDCVIGQKGVVEESDISALPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVFVNVWAIGRDPNVWENSSRFKPERFLGKDIDLRGRDYELTPFGAGRRICPGLPLAVKTVPLMLASLLYSFDWKLPNGVGSEDLDMDETFGLTLHKTNPLHAV 504          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.424e-56
Identity = 104/225 (46.22%), Postives = 146/225 (64.89%), Query Frame = 1
Query:   37 VDALLNLQEEY--ELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVVATP 705
            +D  L + ++   E +   I  L  ++ +AG DTT+IT+EWAM EL++ P +  KA+EEL++V+G   ++ E D   L YL C+VKE +RLHPP+PL+LP K    V++SGY +P G++V VN WAIGRDP  W + LEF+P+RFLE  +D++GHD+ L+PFG+GRRICPGI L   +V  MLG LL++F W     V  + +DM    G       PL VV  P
Sbjct:  264 LDVCLKMMQDNPNEFNHTNIKALFLDLFVAGTDTTSITIEWAMTELLRKPHIMSKAKEELEKVIGKGSIVKEDDVLRLPYLSCIVKEVLRLHPPSPLLLPRKVVTQVELSGYTIPAGTLVFVNAWAIGRDPTVWDDSLEFKPQRFLESRLDVRGHDFDLIPFGAGRRICPGIPLATRMVPIMLGSLLNNFDWKIDTKVPYDVLDMTEKNGTTISKAKPLCVVPIP 488          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.428e-56
Identity = 108/218 (49.54%), Postives = 144/218 (66.06%), Query Frame = 1
Query:   73 LSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFL----EEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVVATPRLA 714
            L+D  I  LL NM  AG DT+  TV+WA+AELI++P +  KAQEELD VVG +R + E+D   L YLQ V+KE+ RLHPPTPL LPH A+   +I+GY++PKGS +  N+WAI RDP  W +PL F+PERFL    +  +D+KG D+ L+PFG+GRRIC G+ LG+  +  +   L+  F W  A GV PE+++M  + G       PL V   PRLA
Sbjct:  287 LTDTEIKALLLNMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLA 504          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.685e-55
Identity = 99/212 (46.70%), Postives = 140/212 (66.04%), Query Frame = 1
Query:   61 EEYELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFLEEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVV 696
            E  +LS+D I  ++  M +AG +TT+ +VEWA+ EL+++P+   K + E+ QV+GPN+   E D  +L Y+Q V+KE +RLHPP PL++P KA  D K  GY++PKG+ V VN WAIGRDP  W NP EF+PERFLE  +D+KG +Y L+PFG+GRR+C G+ LG  ++    G LLH F W     V P+ I+M  + G       PL+V+
Sbjct:  252 EPDKLSEDEITVIILEMFLAGTETTSSSVEWALTELLRHPQAMAKVKLEILQVIGPNKKFEECDIDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKFMGYDIPKGTQVLVNAWAIGRDPEYWDNPFEFKPERFLESKVDVKGQNYELIPFGAGRRMCVGLPLGHRMMHFTFGSLLHEFDWELPHNVSPKSINMEESMGITARKKQPLKVI 463          
BLAST of CN189120 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 7.812e-55
Identity = 105/218 (48.17%), Postives = 147/218 (67.43%), Query Frame = 1
Query:   70 ELSDDTIIGLLWNMIIAGMDTTTITVEWAMAELIKNPRVQQKAQEELDQVVGPNRVMTEADFQNLHYLQCVVKESMRLHPPTPLMLPHKANADVKISGYNVPKGSVVHVNVWAIGRDPADWKNPLEFRPERFL----EEDIDMKGHDYRLLPFGSGRRICPGIQLGINLVTSMLGHLLHHFWWAPAKGVKPEEIDMAGNPGQVTYMTTPLEVVATPRL 711
            +L+D  I  LL N+ +AG DT++ TVEWA+AELI+NP++  +AQ+E+D+VVG +R++ E D   L YL+ +VKE+ RLHP TPL LP  A+   +I+GY +PKGS + +NVWAI RDP  W +PLEFRPERFL    +  +D++G+D+ ++PFG+GRRIC G+ LGI +V  M+  L+H F W    G  PE ++M    G       PL V   PRL
Sbjct:  288 KLTDTEIKALLLNLFVAGTDTSSSTVEWAIAELIRNPKILAQAQQEIDKVVGRDRLVGELDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLLNVWAIARDPNAWADPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLGIRMVQLMIATLIHAFNWDLVSGQLPEMLNMEEAYGLTLQRADPLVVHPRPRL 505          
The following BLAST results are available for this feature:
BLAST of CN189120 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
C98A2_SOYBN1.110e-10976.47Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=... [more]
C98A3_ARATH2.314e-10777.39Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CY... [more]
C98A1_SORBI2.835e-9769.07Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C76C4_ARATH1.797e-5951.12Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C76C1_ARATH5.228e-5949.79Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C76C2_ARATH6.827e-5951.57Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
C76B1_HELTU1.424e-5646.227-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
F3PH_ARATH2.428e-5649.54Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C76A1_SOLME2.685e-5546.70Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]
F3PH_PETHY7.812e-5548.17Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001F14_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001F14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189120 ID=CN189120|Name=CN189120|organism=Citrus sinensis|type=EST|length=730bp
CGTTAAAAGGGTGGAGGAGCTGCTAAGCCACACTTCGTTGATGCGTTGCT
CAATTTGCAAGAGGAATATGAACTTAGTGATGATACAATTATTGGGCTAC
TTTGGAACATGATAATAGCAGGCATGGACACCACAACAATAACTGTAGAA
TGGGCAATGGCAGAGCTCATAAAAAACCCTAGAGTGCAACAAAAAGCTCA
GGAAGAACTAGACCAAGTAGTAGGCCCTAATCGCGTCATGACAGAAGCAG
ACTTTCAAAACCTGCACTATCTCCAGTGCGTGGTCAAAGAATCAATGCGG
CTACACCCACCAACGCCTCTAATGCTGCCCCACAAAGCCAACGCCGATGT
AAAAATCAGCGGCTACAACGTCCCGAAAGGATCAGTCGTACATGTAAACG
TTTGGGCCATAGGCAGAGACCCTGCTGATTGGAAAAACCCGTTGGAATTT
AGGCCTGAGAGGTTCTTAGAGGAGGACATTGACATGAAAGGACACGATTA
TCGATTGTTACCATTTGGTTCGGGGAGAAGAATTTGTCCCGGCATACAAC
TTGGCATAAATTTAGTGACCTCGATGTTGGGTCATCTTTTGCACCATTTT
TGGTGGGCACCGGCTAAAGGAGTGAAGCCTGAGGAAATTGATATGGCCGG
GAACCCTGGACAGGTCACGTACATGACCACACCCCTTGAGGTTGTGGCTA
CCCCGCGGTTGGCTGATCATGGCCTGTACA
back to top