CN189115

Overview
NameCN189115
Unique NameCN189115
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length739
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12367 contig Csv1_Contig12367:25..764. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASPG2_ARATH (Probable isoaspartyl peptidase/L-asparaginase 2 OS=Arabidopsis thaliana GN=At3g16150 PE=2 SV=2)

HSP 1 Score: 385.571 bits (989), Expect = 1.535e-106
Identity = 194/229 (84.72%), Postives = 208/229 (90.83%), Query Frame = 1
Query:   52 MGKWAIAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            MG WAIAVHGGAG+DPNLP +RQE AKQLLTRCLNLGI ALRSN  AIDVVELV+RELETDPLFNSGRGSALTE GTVEMEASIMDG KRRCGAVSG+TTVKNPISLARLVM+KSPHSYLAFSGAE+FAR+QGVE+ DNEYF+T++NVGMLKLAKEANSILFDYRIP  G     AGAAATDSP+QMNGLPIS+YAPETVGCVVVD +G CAA TSTGGLMNK  GRIG
Sbjct:    1 MGGWAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIIALRSNVSAIDVVELVIRELETDPLFNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFSGAEDFARKQGVEIVDNEYFVTDDNVGMLKLAKEANSILFDYRIPPMG----CAGAAATDSPIQMNGLPISIYAPETVGCVVVDGKGHCAAGTSTGGLMNKMMGRIG 225          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASPG_LUPAN (Isoaspartyl peptidase/L-asparaginase OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.376e-61
Identity = 130/230 (56.52%), Postives = 159/230 (69.13%), Query Frame = 1
Query:   52 MGKWAIAVHGGAGVDP-NLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            MG W+IA+HGGAG  P +LP +R++  ++ L  CL +G+ AL+S  P +DVVELVVRELE    FN+G GS LT +GTVEMEASIMDG   +CGAVSGL+TV NPISLARLVM+K+PH YLAF GA++FA+QQGVE  D+ +FIT ENV  LKLA EAN +  DY   N  +   +   A  + PL      I      TVGCV VD  G  A+ATSTGGL+NK  GRIG
Sbjct:    1 MGGWSIALHGGAGDIPFSLPPERRQPREEGLRHCLQIGVEALKSQKPPLDVVELVVRELENIQHFNAGIGSVLTNSGTVEMEASIMDGKTMKCGAVSGLSTVLNPISLARLVMDKTPHIYLAFQGAQDFAKQQGVETVDSSHFITAENVERLKLAIEANRVQVDYSQYN--YPQPAQDDAEKELPLANGDSQIG-----TVGCVAVDSHGNLASATSTGGLVNKMVGRIG 223          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASPG1_ARATH (Isoaspartyl peptidase/L-asparaginase 1 OS=Arabidopsis thaliana GN=At5g08100 PE=1 SV=2)

HSP 1 Score: 232.261 bits (591), Expect = 2.172e-60
Identity = 130/228 (57.02%), Postives = 152/228 (66.67%), Query Frame = 1
Query:   61 WAIAVHGGAGVDP-NLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGF-ETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            WAIA+HGGAG  P +LP +R+   +  L  CL+LGISAL+S  P +DV ELVVRELE  P FN+G+GS LT  GTVEMEASIMDG  +RCGAVSGLTTV NPISLARLVMEK+PH YLAF  AE FAR  GVE  D+ +FIT EN+  LK AKE N +  DY +P+    + C       DS +             TVGCV VD  G  A+ATSTGG +NK  GRIG
Sbjct:    4 WAIALHGGAGDIPIDLPDERRIPRESALRHCLDLGISALKSGKPPLDVAELVVRELENHPDFNAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYLAFDAAEAFARAHGVETVDSSHFITPENIARLKQAKEFNRVQLDYTVPSPKVPDNCG------DSQI------------GTVGCVAVDSAGNLASATSTGGYVNKMVGRIG 213          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASPG_LUPLU (Isoaspartyl peptidase/L-asparaginase OS=Lupinus luteus PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.838e-59
Identity = 128/230 (55.65%), Postives = 157/230 (68.26%), Query Frame = 1
Query:   52 MGKWAIAVHGGAGVDP-NLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            MG W+IA+HGGAG  P +LP +R++  ++ L  CL +G+ AL++  P +DVVELVVRELE    FN+G GS LT +GTVEMEASIMDG   +CGAVSGL+TV NPISLARLVM+K+PH YLAF GA++FA+QQGVE  D+ + IT ENV  LKLA EAN +  DY   N  +       A  + PL      I      TVGCV VD  G  A+ATSTGGL+NK  GRIG
Sbjct:    1 MGGWSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGVEALKAQKPPLDVVELVVRELENIEHFNAGIGSVLTNSGTVEMEASIMDGNTMKCGAVSGLSTVLNPISLARLVMDKTPHIYLAFQGAQDFAKQQGVETVDSSHLITAENVERLKLAIEANRVQVDYSQYN--YPEPVKDDAEKELPLTNGDSQIG-----TVGCVAVDSHGNLASATSTGGLVNKMVGRIG 223          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASPG_LUPAL (Isoaspartyl peptidase/L-asparaginase OS=Lupinus albus PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.192e-58
Identity = 127/230 (55.22%), Postives = 155/230 (67.39%), Query Frame = 1
Query:   52 MGKWAIAVHGGAGVDP-NLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            MG W+IA+HGGAG  P +LP +R++  ++ L  CL +GI AL++  P +DVVELVVRELE    FN+G GS LT +GTVEMEASIMDG   +CGAVSGL TV NPISLAR VM+K+PH +LAF GA++  +QQGVE  D+ +FITEENV  LKLA EAN +  DY   N  +       A  + PL      I      TVGCV VD  G  A+ATSTGGL+NK  GRIG
Sbjct:    1 MGGWSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGIEALKAQNPPLDVVELVVRELENIQHFNAGIGSVLTNSGTVEMEASIMDGNTMKCGAVSGLNTVMNPISLARQVMDKTPHIFLAFQGAQDLGKQQGVETVDSSHFITEENVERLKLAIEANRVQVDYSQYN--YTQPVQDDAEKELPLANGDSQIG-----TVGCVAVDSHGNLASATSTGGLVNKMVGRIG 223          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASPG_LUPAR (Isoaspartyl peptidase/L-asparaginase (Fragment) OS=Lupinus arboreus PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.967e-54
Identity = 116/211 (54.98%), Postives = 144/211 (68.25%), Query Frame = 1
Query:  106 PVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            P +R++  ++ L  CL +G+ AL++    +DVVELVVRELE +  FN+G GS LT +GTVEMEASIMDG   +CGAVSGL+TV NPISLARLVMEK+PH YLAF GA++FA+QQGVE  D+ +FIT ENV  LKLA EAN +  DY   N  +       A  + P+      I      TVGCV VD +G  A+ATSTGGL+NK  GRIG
Sbjct:    1 PPERRKPREEGLRHCLQIGVEALKARKSPLDVVELVVRELENNEHFNAGIGSVLTNSGTVEMEASIMDGKSMKCGAVSGLSTVLNPISLARLVMEKTPHMYLAFQGAQDFAKQQGVETVDSSHFITAENVERLKLAIEANRVQIDYSQYN--YTQPVQDDAEKELPVANGDSQIG-----TVGCVAVDSQGNLASATSTGGLVNKMVGRIG 204          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASGX_DICDI (Putative isoaspartyl peptidase/L-asparaginase OS=Dictyostelium discoideum GN=DDB_G0279357 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.200e-34
Identity = 87/234 (37.18%), Postives = 129/234 (55.13%), Query Frame = 1
Query:   58 KWAIAVHGGAGV--DPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDY----RIPNGGFETCSAGAAATDSPLQMNGLPIS-LYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            K  + +HGGAGV     +  +R+E     L   L  G   L+    ++DVV+  VR LE DP++N+G+GS  TE GT EM+A+IMDG   + GAV G++ ++NPI  AR VME + H  L   GAEEFA+ + +E+ +  +F T+     L  AK+   ++ D+     +     +  +   + T + + +   PI   Y   TVG V +D  G  AAATSTGG+ NK  GR+G
Sbjct:    4 KSVLVIHGGAGVISKSTISKEREEIFLNSLKNILLAGKIILKQGGTSLDVVQEAVRLLEEDPIYNAGKGSVFTELGTNEMDAAIMDGTNLKAGAVGGVSIIRNPIIAARAVMEHTNHCLLVGKGAEEFAKSKNLEIVEPSFFFTQNRYDQLLRAKDEKKLILDHDGENLLEKEKEKEKNNETSTTTTTISVGVDPIDPKYKMGTVGAVCLDSFGNLAAATSTGGMTNKMHGRVG 237          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASGL1_HUMAN (L-asparaginase OS=Homo sapiens GN=ASRGL1 PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 5.042e-33
Identity = 91/224 (40.62%), Postives = 112/224 (50.00%), Query Frame = 1
Query:   67 IAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            + VHGG G  P +   R+E   Q + R   +G   LR    A+D VE  V  LE DP FN+G GS L  NG VEM+ASIMDG     GAVS +  + NPI LARLVMEK+PH +L   GA +FA   GV     E  +TE N   L+  K                     GA  TD    +           TVG V +D +G  A ATSTGG++NK  GR+G
Sbjct:    5 VVVHGG-GAGP-ISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKH------------------EKGAQKTDCQKNLG----------TVGAVALDCKGNVAYATSTGGIVNKMVGRVG 198          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASGL1_MACFA (L-asparaginase OS=Macaca fascicularis GN=ASRGL1 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.502e-32
Identity = 90/224 (40.18%), Postives = 113/224 (50.45%), Query Frame = 1
Query:   67 IAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            + VHGG G  P +   R+E   Q + R   +G   LR    A+D VE  V  LE DP FN+G GS L  +G VEM+ASIMDG     GAVS +  + NPI LARLVMEK+PH +L   GA +FA   GV     E  +TE+N   L+  K                     GA  TD    +           TVG V +D +G  A ATSTGG++NK  GR+G
Sbjct:    5 VVVHGG-GAGP-ISKDRKERMHQGIVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTDGEVEMDASIMDGKDLSVGAVSAVRCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTEKNKKRLEKEKH------------------EKGAQKTDCEKNLG----------TVGAVALDFKGNVAYATSTGGIVNKMVGRVG 198          
BLAST of CN189115 vs. ExPASy Swiss-Prot
Match: ASGL1_MOUSE (L-asparaginase OS=Mus musculus GN=Asrgl1 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.268e-32
Identity = 86/224 (38.39%), Postives = 110/224 (49.11%), Query Frame = 1
Query:   67 IAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIG 738
            + VHGG     N+   R+E  ++ + R    G   L++   A+D VE  V  LE DP FN+G GS L  NG +EM+ASIMDG     GAVS +  + NP+ LARLVMEK+PH +L   GAE+FA   G+     E  ITE     L+                   E    GA   D P              TVG V +D  G  A ATSTGG++NK  GR+G
Sbjct:   22 VVVHGGGA--SNISANRKELVREGIARAATEGYKILKAGGSAVDAVEGAVTVLENDPEFNAGYGSVLNVNGDIEMDASIMDGKDLSAGAVSAVRCIANPVKLARLVMEKTPHCFLTGHGAEKFAEDMGIPQVPVEKLITERTKKHLEK------------------EKLEKGAQNADCPKNSG----------TVGAVALDCRGNLAYATSTGGIVNKMVGRVG 215          
The following BLAST results are available for this feature:
BLAST of CN189115 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
ASPG2_ARATH1.535e-10684.72Probable isoaspartyl peptidase/L-asparaginase 2 OS... [more]
ASPG_LUPAN4.376e-6156.52Isoaspartyl peptidase/L-asparaginase OS=Lupinus an... [more]
ASPG1_ARATH2.172e-6057.02Isoaspartyl peptidase/L-asparaginase 1 OS=Arabidop... [more]
ASPG_LUPLU1.838e-5955.65Isoaspartyl peptidase/L-asparaginase OS=Lupinus lu... [more]
ASPG_LUPAL1.192e-5855.22Isoaspartyl peptidase/L-asparaginase OS=Lupinus al... [more]
ASPG_LUPAR3.967e-5454.98Isoaspartyl peptidase/L-asparaginase (Fragment) OS... [more]
ASGX_DICDI1.200e-3437.18Putative isoaspartyl peptidase/L-asparaginase OS=D... [more]
ASGL1_HUMAN5.042e-3340.63L-asparaginase OS=Homo sapiens GN=ASRGL1 PE=1 SV=2[more]
ASGL1_MACFA2.502e-3240.18L-asparaginase OS=Macaca fascicularis GN=ASRGL1 PE... [more]
ASGL1_MOUSE3.268e-3238.39L-asparaginase OS=Mus musculus GN=Asrgl1 PE=1 SV=1[more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001F12_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189115 ID=CN189115|Name=CN189115|organism=Citrus sinensis|type=EST|length=739bp
CAGACGAGGGGGCGAGAGCGCGTGAGCANAAGCAAAAACAACCGAAAGAA
AATGGGAAAATGGGCTATAGCGGTGCATGGTGGCGCTGGCGTGGACCCCA
ATCTTCCCGTGCAACGACAAGAGGCCGCCAAACAACTCCTCACTCGCTGC
CTTAATCTTGGCATCTCCGCTCTTCGCTCTAACTGCCCTGCTATCGACGT
CGTCGAACTCGTTGTGAGAGAACTGGAAACGGATCCTCTGTTCAACTCTG
GCCGTGGATCTGCACTTACGGAGAATGGAACGGTGGAGATGGAGGCGAGC
ATTATGGACGGGCCCAAGAGACGCTGCGGCGCCGTATCTGGGCTTACCAC
CGTTAAAAACCCTATATCTCTTGCGCGACTCGTCATGGAGAAATCTCCCC
ATTCATATCTCGCCTTCTCTGGGGCCGAGGAATTCGCCAGACAGCAGGGT
GTTGAGTTGTTCGACAATGAATACTTCATCACCGAAGAGAACGTGGGAAT
GTTAAAATTAGCCAAGGAAGCAAACTCAATCCTGTTTGATTACAGAATTC
CAAACGGGGGATTCGAAACCTGCAGCGCTGGAGCTGCAGCCACAGACAGC
CCCTTGCAAATGAACGGACTTCCAATAAGCCTGTACGCCCCAGAAACGGT
TGGGTGCGTTGTGGTTGACCAGGAGGGTCGGTGCGCTGCAGCCACGTCAA
CGGGAGGGCTGATGAATAAGAGGACCGGCAGAATCGGTG
back to top