CN188945

Overview
NameCN188945
Unique NameCN188945
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length763
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188945_ssr231 microsatellite CN188945_ssr231:231..248. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2692 contig Csv1_Contig2692:1..773. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188945 vs. ExPASy Swiss-Prot
Match: JKD_ARATH (Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 7.668e-56
Identity = 105/160 (65.62%), Postives = 119/160 (74.38%), Query Frame = 1
Query:  328 LQMMSGNAFTIPSSLGGFVHQEXXXXXXXXXXXXXXXXX----------------RNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWE 759
            +QM+ G+ F+I SS+GGFVHQE                                 RN PGTPDPDA+VIALSP TLMATNRF+CEICNKGFQRDQNLQLHRRGHNLPWKL+QR+ ++VIKKKVYICP KTCVHH+ SRALGDLTGIKKH+SRKHGEKKW+
Sbjct:    1 MQMIPGDPFSISSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNAKPNSSSAKKKRNQPGTPDPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSKQEVIKKKVYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWK 160          
BLAST of CN188945 vs. ExPASy Swiss-Prot
Match: MGP_ARATH (Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 9.700e-51
Identity = 89/105 (84.76%), Postives = 100/105 (95.24%), Query Frame = 1
Query:  445 RNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWE 759
            RNLPG PDP+AEVIALSPKTLMATNRF+CEIC KGFQRDQNLQLHRRGHNLPWKL+QRT+K+V +K+VY+CPEK+CVHH P+RALGDLTGIKKHF RKHGEKKW+
Sbjct:   44 RNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWK 147          
BLAST of CN188945 vs. ExPASy Swiss-Prot
Match: NUC_ARATH (Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.814e-50
Identity = 95/139 (68.35%), Postives = 105/139 (75.54%), Query Frame = 1
Query:  340 SGNAFTIPSSLGGFVHQEXXXXXXXXXXXXXXXXXRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKW 756
            SG+ F  P S     H E                 RNLPG PDP+AEVIALSP TLMATNRF+CE+C KGFQRDQNLQLHRRGHNLPWKL+QRT+K+V +K+VY+CPEKTCVHH  SRALGDLTGIKKHF RKHGEKKW
Sbjct:   11 SGSGFAQPQSSSTLDHDESLINPPLVKKK------RNLPGNPDPEAEVIALSPTTLMATNRFLCEVCGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKRVYVCPEKTCVHHHSSRALGDLTGIKKHFCRKHGEKKW 142          
The following BLAST results are available for this feature:
BLAST of CN188945 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
JKD_ARATH7.668e-5665.63Zinc finger protein JACKDAW OS=Arabidopsis thalian... [more]
MGP_ARATH9.700e-5184.76Zinc finger protein MAGPIE OS=Arabidopsis thaliana... [more]
NUC_ARATH4.814e-5068.35Zinc finger protein NUTCRACKER OS=Arabidopsis thal... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001B07_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188945 ID=CN188945|Name=CN188945|organism=Citrus sinensis|type=EST|length=763bp
GCGGTTAAGAAGAGCTTACAAAATAAGAGCAGATAATACTCTTCTTGAGA
TAGCAGCAATCATAAGTTGTTGGAGTTTTCTTTTGAAATTGATCAAAACA
AAACCAGATCTCTGTAACAAGAGTCCGAAATATATTTTTGTTTTTAGATT
AAAATTTTGAGTTTTTTTTTTCCTCCTTTCCTTCTCTTTTCTTGTCTTTT
GGCTTGAATCTCAGAGTCATCAGAATTTGAATATATATATATATATATAC
CAAACATTTATCAGCTTCTGTTTGGAGGAAAAAAAAAAGCACAAAACAAA
ACCCTTAGTTTTTTGCACTTTGATAGCTTGCAAATGATGTCTGGTAATGC
TTTTACAATACCCTCTTCCTTAGGAGGGTTTGTTCATCAAGAACAAAATC
CCAACCCTAACCCTAAACCTAATCAGGCTGCCAGTAAAAAGAAGAGGAAT
TTACCGGGAACTCCAGATCCAGATGCTGAGGTTATTGCTCTATCCCCAAA
GACACTCATGGCAACCAACAGATTCATATGTGAAATATGCAATAAGGGTT
TCCAAAGAGACCAAAACTTACAGCTTCATCGAAGAGGACATAATCTTCCA
TGGAAGCTGAGGCAAAGAACCAACAAAGACGTCATCAAGAAGAAAGTTTA
TATCTGCCCAGAAAAGACTTGTGTTCATCACGAACCATCGAGGGCTCTCG
GTGATTTGACGGGTATAAAGAAGCATTTTAGCAGAAAACATGGAGAAAAG
AAATGGGAAGTGT
back to top