CN188943

Overview
NameCN188943
Unique NameCN188943
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length710
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9763 contig Csv1_Contig9763:18..727. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 340.117 bits (871), Expect = 6.920e-93
Identity = 179/231 (77.49%), Postives = 194/231 (83.98%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREALELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCGYGLKPARPQGDSFIHALECEPTLPIG 708
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFC++SSM+KTLERYQKCNYGAPE N+S REALE++SQQEYLKLKARYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EAN+TL QR             LMEG  +N LQ   +A+D GYG +  + QGD F H LECEPTL IG
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQR-------------LMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIG 217          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 3.009e-88
Identity = 173/236 (73.31%), Postives = 194/236 (82.20%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREA--LELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCGYGL-KPARPQGDSF--IHALECEPTLPIG 708
            MGRGRVELKR+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFC+TSSM+KTLERYQKCNYGAPE NV+++EA  LEL+SQQEYLKLKARYE+LQRSQRNL+GE+LGPL+SK+LE+LERQLD SLKQIRSTRTQ+MLD L +LQ KE LL EAN+ L QR              MEGYQ+N+LQLN SAED GYG        GD    +  +ECEPTL IG
Sbjct:    1 MGRGRVELKRVENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSSMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQRSQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRALRQR--------------MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIG 222          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: AGL9_SOLLC (Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 7.524e-84
Identity = 158/193 (81.87%), Postives = 169/193 (87.56%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREALELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLMEGYQVN 594
            MGRGRVELKRIE KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFC++SSM+KTLERYQKCNYGAPEPN+S REALE++SQQEYLKLK RYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+ Q KE  L+EAN+TL QR             LMEG Q+N
Sbjct:    1 MGRGRVELKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALEISSQQEYLKLKGRYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQR-------------LMEGSQLN 180          

HSP 2 Score: 29.261 bits (64), Expect = 7.524e-84
Identity = 15/31 (48.39%), Postives = 19/31 (61.29%), Query Frame = 2
Query:  614 VQKIVVMGLNQLDLRAIASFTPWNVNPHCQL 706
            + K+  M   QL LRA+ASF  W VN  C+L
Sbjct:  186 MHKLWAMAGKQLKLRAMASFILWIVNLLCKL 216          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.889e-82
Identity = 167/236 (70.76%), Postives = 191/236 (80.93%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREAL--ELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCG-YGLKPARPQ--GDSFIHALECEPTLPIG 708
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFC++SSM++TLERYQKCNYGAPEPNV +REAL  EL+SQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELESLERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL              L+L +GYQ+  LQLNP+ E+   YG    + Q    +F   LECEP L IG
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL-------------RLRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIG 222          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 9.374e-82
Identity = 166/238 (69.75%), Postives = 190/238 (79.83%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREAL--ELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAED--CGYGLKPARPQGDS---FIHALECEPTLPIG 708
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFC++SSM++TLERYQKCNYG PEPNV +REAL  EL+SQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELE LERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL              L+L +GYQ+  LQLNP+ ED    YG    + Q +S   F   LECEP L +G
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKTL-------------RLRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMG 224          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 4.815e-78
Identity = 158/233 (67.81%), Postives = 181/233 (77.68%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREALELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLMEGYQVNTLQL-NPS-AEDCGYGLKPARPQGDSFIHALECEPTLPIG 708
            MGRGRVELK IENKINRQVTFAKRR  LLKKAYELSVLCDAEVALIIFSNRGKLYEFC+++SM+KTLE+YQKCN+G+PE  + +RE    +SQQEYLKLK R EALQRSQRNLLGE+LGPL SKELE LERQLD SL+QIRSTRTQ+MLD L +LQ +EQ+L EANKTL +R               E  Q N  Q+ +PS     GYG +PA+  G++F H LECEPTL IG
Sbjct:    1 MGRGRVELKMIENKINRQVTFAKRRKRLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRET--QSSQQEYLKLKNRVEALQRSQRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRR-------------FEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEPTLQIG 218          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: SEP2_ARATH (Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 9.723e-71
Identity = 147/234 (62.82%), Postives = 173/234 (73.93%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREALELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQR---TMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCGYGLKPARPQGDSFIHALECEPTLPIG 708
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LI+FSNRGKLYEFC+TS+M+KTLERYQKC+YG+ E N    + LE  S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+R  +TQYMLD L++LQ KE +L +AN+ L  +    + +RH    G     G++          ++  YG   A  QG     +LEC+PTL IG
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGG-----GWE------GGDQQNIAYGHPQAHSQG--LYQSLECDPTLQIG 220          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: SEP1_ARATH (Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2)

HSP 1 Score: 263.848 bits (673), Expect = 6.303e-70
Identity = 146/234 (62.39%), Postives = 169/234 (72.22%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREALELTSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQR---TMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCGYGLKPARPQGDSFIHALECEPTLPIG 708
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFC++S+M+KTL+RYQKC+YG+ E N    + LE  S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+RS +TQYMLD L++LQ+KEQ+L E N+ L  +    + +R     G    EG + N    +  A            Q       LEC PTL +G
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQA------------QSQGLYQPLECNPTLQMG 221          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 6.968e-69
Identity = 146/235 (62.13%), Postives = 173/235 (73.62%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREALEL-TSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLME-GYQVNTLQLNPSAEDCGYGLKPARPQGDSFIHALEC--EPTLPIG 708
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFC+T SM KTLE+YQKC+Y  PE  V  RE+ +L  S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L ++     H    G Q+ E G  +   +  P  +   +G       G+ F H L+   EPTL IG
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHV--RGQQVWEQGCNLIGYERQPEVQQPLHG-------GNGFFHPLDAAGEPTLQIG 226          
BLAST of CN188943 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 6.968e-69
Identity = 146/235 (62.13%), Postives = 173/235 (73.62%), Query Frame = 1
Query:   16 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCTTSSMVKTLERYQKCNYGAPEPNVSAREALEL-TSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLGQRTMTLRHAAFAGLQLME-GYQVNTLQLNPSAEDCGYGLKPARPQGDSFIHALEC--EPTLPIG 708
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFC+T SM KTLE+YQKC+Y  PE  V  RE+ +L  S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L ++     H    G Q+ E G  +   +  P  +   +G       G+ F H L+   EPTL IG
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHV--RGQQVWEQGCNLIGYERQPEVQQPLHG-------GNGFFHPLDAAGEPTLQIG 226          
The following BLAST results are available for this feature:
BLAST of CN188943 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AGL9_PETHY6.920e-9377.49Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
MTF1_PEA3.009e-8873.31MADS-box transcription factor 1 OS=Pisum sativum G... [more]
AGL9_SOLLC7.524e-8481.87Agamous-like MADS-box protein AGL9 homolog OS=Sola... [more]
SEP3_ARATH1.889e-8270.76Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SINAL9.374e-8269.75Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_ARADE4.815e-7867.81Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
SEP2_ARATH9.723e-7162.82Developmental protein SEPALLATA 2 OS=Arabidopsis t... [more]
SEP1_ARATH6.303e-7062.39Developmental protein SEPALLATA 1 OS=Arabidopsis t... [more]
MADS7_ORYSJ6.968e-6962.13MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS7_ORYSI6.968e-6962.13MADS-box transcription factor 7 OS=Oryza sativa su... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001B06_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188943 ID=CN188943|Name=CN188943|organism=Citrus sinensis|type=EST|length=710bp
GCGTAGGAGAAGAAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGA
GAACAAGATCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTTT
TGAAGAAAGCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTC
ATCATTTTCTCCAATAGAGGAAAGCTGTACGAGTTTTGCACTACTTCAAG
CATGGTCAAAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAG
AACCGAATGTGTCCGCAAGGGAGGCCCTGGAGCTAACTAGCCAGCAAGAA
TATCTGAAGCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAA
TCTCCTTGGAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCAC
TTGAAAGGCAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACT
CAGTACATGCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCT
GAGCGAAGCAAATAAGACCCTCGGACAAAGGACGATGACGCTAAGGCACG
CCGCTTTTGCTGGTTTGCAGTTGATGGAGGGATACCAAGTGAACACACTT
CAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGCTCG
ACCTCAGGGCGATAGCTTCATTCACGCCTTGGAATGTGAACCCACATTGC
CAATTGGATA
back to top