CN188936

Overview
NameCN188936
Unique NameCN188936
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length726
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188936_ssr295 microsatellite CN188936_ssr295:295..314. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7862 contig Csv1_Contig7862:354..1079. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188936 vs. ExPASy Swiss-Prot
Match: NAC2_ARATH (NAC domain-containing protein 2 OS=Arabidopsis thaliana GN=NAC002 PE=2 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 1.014e-22
Identity = 55/94 (58.51%), Postives = 69/94 (73.40%), Query Frame = -2
Query:  351 NDYMYFDTSDSVPKLNT-DSSCSEHVVSPEFTCEVQSEPKMQPW-------ENTLGFPYNYLDSTMDISFNSQFQGNNQLSPLQDMFMYLPKPF 608
            +++ YFDTSDSVPKL+T DSSCSE VVSPEFT EVQSEPK + W        NTL F +NY+D+T+D +F      +NQ+ PLQDMFMY+ KP+
Sbjct:  197 SEFAYFDTSDSVPKLHTTDSSCSEQVVSPEFTSEVQSEPKWKDWSAVSNDNNNTLDFGFNYIDATVDNAFGGG-GSSNQMFPLQDMFMYMQKPY 289          
BLAST of CN188936 vs. ExPASy Swiss-Prot
Match: NAC48_ORYSJ (NAC domain-containing protein 48 OS=Oryza sativa subsp. japonica GN=NAC48 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.242e-12
Identity = 49/126 (38.89%), Postives = 67/126 (53.17%), Query Frame = -2
Query:  351 EKKPVVMPSGMDKSTSGGALIPNPASTVTGTGTVNDYMYFDT-SDSVPKLNTDSSCSEHVVSPEFTCEVQSEPKMQPWENTLGF--PYNYLDSTMDISFN---SQFQGNNQLSPLQDMFMYLPKPF 710
            ++KP+V   G++ + S     P     V G    +   Y+D  SDS+P+L+ DSSCSE V+SPEF CEVQS+PK+  WE T     P N   S +D + +       G      LQD+ MY  KPF
Sbjct:  184 QRKPMV---GVNAAVSSP---PEQKPVVAGPAFPDLAAYYDRPSDSMPRLHADSSCSEQVLSPEFACEVQSQPKISEWERTFATVGPINPAASILDPAGSGGLGGLGGGGSDPLLQDILMYWGKPF 303          
The following BLAST results are available for this feature:
BLAST of CN188936 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NAC2_ARATH1.014e-2258.51NAC domain-containing protein 2 OS=Arabidopsis tha... [more]
NAC48_ORYSJ1.242e-1238.89NAC domain-containing protein 48 OS=Oryza sativa s... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001B02_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188936 ID=CN188936|Name=CN188936|organism=Citrus sinensis|type=EST|length=726bp
TTTTTTTTACTTGATAAAACAATAAGACACACTACTGATTTGATATAACA
TTTTTGGAACACTACATTTAATAACTTCCTAAAAAAAAAGAAAAATTAAA
ACATATTAACATCATCACATGCCGCGTGCTGTACACATGCTAATGATTAA
TGATTATATGCTTGCAAATCCAGCATTAACCGTCCGATCAATCAGACCAA
TCGTCCGAAAGAACGTAGGGCTTACTATATCGTCAACTGGGCCCCGCACC
GCACAGGCACACTCATTGACTTTCGTCTCGTGTTGCCTCTTTCAAGGCCA
GGCCAGGCCAGGCCAGCCCGTCTATGGTCCATCCACTCGACCCAAATTTA
AAAGGGTTTCGGAAGGTACATGAACATATCCTGCAACGGCGACAGCTGAT
TGTTTCCCTGAAACTGAGAATTGAAGCTTATGTCCATGGTGGAATCCAAG
TAATTATATGGAAAACCAAGGGTGTTTTCCCAGGGTTGCATTTTAGGCTC
GCTCTGCACCTCGCACGTGAACTCCGGTGACACCACGTGCTCCGAGCAAC
TCGAGTCCGTGTTCAGCTTCGGCACCGAATCCGACGTGTCAAAATACATG
TAATCATTCACTGTTCCCGTTCCTGTTACGGTCGACGCCGGATTCGGAAT
CAGTGCTCCTCCTGACGTTGACTTGTCCATGCCACTTGGCATAACCACCG
GTTTCTTCTCCTCCGTCTCCGTCTCC
back to top