CN188931

Overview
NameCN188931
Unique NameCN188931
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length727
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9577 contig Csv1_Contig9577:294..1020. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: Y1765_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.597e-28
Identity = 61/122 (50.00%), Postives = 90/122 (73.77%), Query Frame = -3
Query:  360 ADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRFKTLRDHPRRNE 725
            ADVYSFGVVALEIVSGK+N ++ P  +    LDWA+ L   G+L+ELVDP L S++++ EA  M+ +AL+CTNASP+LRPTMS+VVS++EG + + +++ +    + + + K LR+H  +NE
Sbjct:  862 ADVYSFGVVALEIVSGKSNTNFRPTEDFVYLLDWAYVLQERGSLLELVDPTLASDYSEEEAMLMLNVALMCTNASPTLRPTMSQVVSLIEGKTAMQELLSDPSFSTVNPKLKALRNHFWQNE 983          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 8.860e-27
Identity = 69/117 (58.97%), Postives = 80/117 (68.38%), Query Frame = -3
Query:  384 ADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI--PDVIPEAG-GLSEDLRFKTL 725
            ADVYSFGVV LEIVSGK+N +Y P       LDWA+ L   G+L+ELVDP LG+ F+K EA RM+ IALLCTN SP+LRP MS VVSMLEG   +  P V  EA    S  +RFK L
Sbjct:  852 ADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQPPLVKREADPSGSAAMRFKAL 968          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: Y5344_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 2.578e-26
Identity = 68/117 (58.12%), Postives = 80/117 (68.38%), Query Frame = -3
Query:  384 ADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI--PDVIPEAG-GLSEDLRFKTL 725
            ADVYSFGVV LEIVSGK+N +Y P       LDWA+ L   G+L+ELVDP LG+ F+K EA RM+ IALLCTN SP+LRP MS VVSML+G   +  P V  EA    S  +RFK L
Sbjct:  850 ADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKVQPPLVKREADPSGSAAMRFKAL 966          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: RKF1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.014e-22
Identity = 57/122 (46.72%), Postives = 81/122 (66.39%), Query Frame = -3
Query:  360 ADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRFKTLRDHPRRNE 725
            ADVYSFGV+ LEIV+G  N +++   +  C L++A     SG LM++VD RL  E ++ EAE +IK+AL+C++ASP+ RP MSEVV+MLEG   +P+  P     + D+RFK  +D  R  E
Sbjct:  864 ADVYSFGVLVLEIVAGITNSNFMGAGDSVCLLEFANECVESGHLMQVVDERLRPEVDRKEAEAVIKVALVCSSASPTDRPLMSEVVAMLEGLYPVPESTPGVSRNAGDIRFKAFKDLRRGME 985          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 2.497e-21
Identity = 57/126 (45.24%), Postives = 77/126 (61.11%), Query Frame = -3
Query:  351 ADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIP-DVIPEAGGLSEDLRFKTLRDHPRRNE*FG 725
            ADVYSFG+VALEIV G++N      +N    +DW   L     L+ELVDPRLGSE+N+ EA  MI+IA++CT++ P  RP+MSEVV MLEG   +  + + EA    E  R + +    +  E  G
Sbjct:  807 ADVYSFGIVALEIVHGRSNKIERSKNNTFYLIDWVEVLREKNNLLELVDPRLGSEYNREEAMTMIQIAIMCTSSEPCERPSMSEVVKMLEGKKMVEVEKLEEASVHRETKRLENMNTMKKYYEMIG 932          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: Y5614_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.370e-19
Identity = 56/124 (45.16%), Postives = 76/124 (61.29%), Query Frame = -3
Query:  363 DVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLS----EDLRFKTLRDHPRRN 722
            DVY+FGVVALE+VSG+ N     +      L+WA++LH  G  +EL+D +L +EFN  E +RMI IALLCT  S +LRP MS VV+ML G   + DV  + G L+    +D    ++   P RN
Sbjct:  875 DVYAFGVVALELVSGRPNSDENLEDEKRYLLEWAWNLHEKGREVELIDHQL-TEFNMEEGKRMIGIALLCTQTSHALRPPMSRVVAMLSGDVEVSDVTSKPGYLTDWRFDDTTASSISGFPLRN 997          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 6.800e-19
Identity = 55/110 (50.00%), Postives = 72/110 (65.45%), Query Frame = -3
Query:  393 DVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRF 722
            DVY+FGVVALE+VSG+ N     +      L+WA++LH     +EL+D +L ++FN  EA+RMI IALLCT  S +LRP MS VV+ML G   I DV  + G +S D RF
Sbjct:  876 DVYAFGVVALELVSGRPNSDENLEEEKKYLLEWAWNLHEKSRDIELIDDKL-TDFNMEEAKRMIGIALLCTQTSHALRPPMSRVVAMLSGDVEIGDVTSKPGYVS-DWRF 983          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: CRK3_ARATH (Cysteine-rich receptor-like protein kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.857e-17
Identity = 44/95 (46.32%), Postives = 63/95 (66.32%), Query Frame = -3
Query:  441 ADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI 725
            ADVYSFGV+ +E+++GK N ++V D+       W+  L+R+  + E VDP LG  FNK+EA R+++I LLC  A+   RP MS VV M++GS  I
Sbjct:  505 ADVYSFGVLMIEVITGKRNNAFVQDAGSILQSVWS--LYRTSNVEEAVDPILGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSVVVKMMKGSLEI 597          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: LRKA1_ARATH (Lectin-domain containing receptor kinase A4.1 OS=Arabidopsis thaliana GN=LECRKA4.1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.956e-14
Identity = 39/103 (37.86%), Postives = 60/103 (58.25%), Query Frame = -3
Query:  417 ADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAG 725
            +DV++FGV+ LEIV G+       DS     +DW   LH +G ++  +DPRLGS ++  EA   + + LLC +  P+ RP+M  V+  L G  N+P++  E G
Sbjct:  551 SDVFAFGVLLLEIVCGRKPT----DSGTFFLVDWVMELHANGEILSAIDPRLGSGYDGGEARLALAVGLLCCHQKPASRPSMRIVLRYLNGEENVPEIDDEWG 649          
BLAST of CN188931 vs. ExPASy Swiss-Prot
Match: CRK35_ARATH (Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.861e-14
Identity = 46/106 (43.40%), Postives = 63/106 (59.43%), Query Frame = -3
Query:  414 ADVYSFGVVALEIVSGKNNMSY--VPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGG 725
            +DVYSFGV+ LEI+SGK N S+  + DS     +  A+ L R+G+ +ELVDP +G  +   EA R I IALLC    P+ RP +  ++ ML  S+    V P A G
Sbjct:  528 SDVYSFGVLVLEIISGKKNSSFYNIDDSGSNL-VTHAWRLWRNGSPLELVDPTIGESYQSSEATRCIHIALLCVQEDPADRPLLPAIIMMLTSSTTTLHV-PRAPG 631          
The following BLAST results are available for this feature:
BLAST of CN188931 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
Y1765_ARATH3.597e-2850.00Probable LRR receptor-like serine/threonine-protei... [more]
Y5343_ARATH8.860e-2758.97Probable LRR receptor-like serine/threonine-protei... [more]
Y5344_ARATH2.578e-2658.12Probable LRR receptor-like serine/threonine-protei... [more]
RKF1_ARATH1.014e-2246.72Probable LRR receptor-like serine/threonine-protei... [more]
Y1534_ARATH2.497e-2145.24Probable LRR receptor-like serine/threonine-protei... [more]
Y5614_ARATH1.370e-1945.16Probable LRR receptor-like serine/threonine-protei... [more]
Y1561_ARATH6.800e-1950.00Probable LRR receptor-like serine/threonine-protei... [more]
CRK3_ARATH2.857e-1746.32Cysteine-rich receptor-like protein kinase 3 OS=Ar... [more]
LRKA1_ARATH2.956e-1437.86Lectin-domain containing receptor kinase A4.1 OS=A... [more]
CRK35_ARATH3.861e-1443.40Putative cysteine-rich receptor-like protein kinas... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001A23_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001A23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188931 ID=CN188931|Name=CN188931|organism=Citrus sinensis|type=EST|length=727bp
GACGGAAAATTTTAGATACAAAGATGATGCGAGAAGGTATGACACATAGA
CGTAGGTTACAAAAAAGTTGAATGTTGAAACTTGAAACTAGCTTGCGGAT
GATTTTGCACATCCGCTGGACTCAAATTGTGTTGTGAAGATCATGGGCAG
ATTGTGAAGAACCAGTCCATGAGGGGACTGGTGTTGATAATTGGGCAACC
GATCTTTGTCTTTCCATATGAATATGACTGTCTCTCATGGCCTTAAACTT
CAAATATGCCTCTGCATTAATTTCACGGACATCATCGGTAGAGGAAGAAC
CAGGCAAGAAGCTGGCTGACGATGAATAATGAGACAGACTTCCTTCCAAA
CCCGAACTATTCATTTCGGCGTGGATGGTCTCTTAGAGTTTTAAACCTCA
AGTCTTCACTCAAACCACCGGCTTCAGGGATTACATCCGGAATGTTAGAA
GATCCTTCCAGCATGCTTACCACTTCAGACATGGTTGGCCTTAGTGAAGG
TGACGCATTGGTGCATAAGAGTGCTATTTTAATCATTCTCTCTGCTTCAA
CCTTGTTGAATTCTGATCCGAGCCTTGGATCCACTAACTCCATTAACGTA
CCACTTCGGTGTAAATGGAAGGCCCAGTCAAGAGGACAGGTGCAATTACT
GTCTGGCACATAACTCATATTATTCTTCCCACTGACGATTTCCAAAGCCA
CAACTCCGAAACTGTAAACATCTGCTT
back to top