CN188928

Overview
NameCN188928
Unique NameCN188928
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length740
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7791 contig Csv1_Contig7791:240..979. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 6.464e-97
Identity = 174/179 (97.21%), Postives = 179/179 (100.00%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  256 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 6.050e-95
Identity = 169/179 (94.41%), Postives = 178/179 (99.44%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP
Sbjct:  256 ETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.032e-94
Identity = 169/179 (94.41%), Postives = 177/179 (98.88%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VAS SKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  256 ETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.760e-94
Identity = 169/179 (94.41%), Postives = 176/179 (98.32%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG VASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  256 ETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGIVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 3.921e-94
Identity = 167/179 (93.30%), Postives = 177/179 (98.88%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  256 ETGVVKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 5.121e-94
Identity = 168/179 (93.85%), Postives = 175/179 (97.77%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  256 ETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 8.736e-94
Identity = 165/179 (92.18%), Postives = 178/179 (99.44%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGV+KNV+KKDP
Sbjct:  256 ETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 340.117 bits (871), Expect = 7.395e-93
Identity = 166/179 (92.74%), Postives = 175/179 (97.77%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAANFT+QVII+NHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  256 ETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.261e-92
Identity = 167/179 (93.30%), Postives = 174/179 (97.21%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELE  PKFLKNGDAG+VKMIPTKPMVVETF+ YPPLGRFAVRDMRQTVAVGVIK VEKKDP
Sbjct:  256 ETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQTVAVGVIKGVEKKDP 434          
BLAST of CN188928 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 6.260e-92
Identity = 163/179 (91.06%), Postives = 175/179 (97.77%), Query Frame = -1
Query:  204 ETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 740
            ETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSE++TKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct:  256 ETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP 434          
The following BLAST results are available for this feature:
BLAST of CN188928 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 178
Match NameE-valueIdentityDescription
EF1A_ORYSJ6.464e-9797.21Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_TOBAC6.050e-9594.41Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_MAIZE1.032e-9494.41Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_MANES1.760e-9494.41Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_VICFA3.921e-9493.30Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A2_DAUCA5.121e-9493.85Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A_SOLLC8.736e-9492.18Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_SOYBN7.395e-9392.74Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_WHEAT1.261e-9293.30Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_ARATH6.260e-9291.06Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001A22_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001A22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188928 ID=CN188928|Name=CN188928|organism=Citrus sinensis|type=EST|length=740bp
TTTTTTTTTTTTTTTTTATCACTTACCAAAAAAAAACTCTGATATAAAAC
CAAATTCAGAGAATTAAAATGAAGTCCCGTAAAACAAACTAAAACACGAC
AAAAATAGCATAAACAGAGAAAATAAAAGCTAACTATAGCAGATAGATCC
CAAAAAACTCCTCACTTCTTCTTGGCTGCAGACTTGGTGACCTTGGCACC
TGTTGGATCCTTCTTTTCAACATTCTTAATCACACCAACAGCAACAGTCT
GACGCATGTCCCTAACGGCAAAACGACCAAGAGGTGGGTAGTCAGAGAAG
GTTTCAACAACCATGGGCTTGGTGGGAATCATCTTAACCATTCCAGCATC
TCCATTCTTCAAGAACTTGGGCTCCTTCTCAAGCTCCTTGCCTGATCGCC
TATCAATCTTCGTCACGAGCTCAGAAAACTTGACGGCAATGTGGGAGGTG
TGGCAGTCAAGCACTGGGGCATATCCATTTCCAATCTGGCCAGGGTGGTT
CATGATGATGACCTGTGAGGTGAAGTTGGCAGCTTCCCTGGCTGGATCAT
CCTTCGAGTTGGAAGCAACAAAACCACGCTTGAGATCCTTGACAGCAACG
TTCTTCACGTTGAAGCCAACATTGTCACCCGGAAGGGCCTCCTGCAGAGC
TTCGTGGTGCATCTCAACAGACTTAACCTCAGTTGTCAATCCAGAGGGGC
CAAATGTCACCACCATACCAGGCTTGAGGACACCGGTCTC
back to top