CN188899

Overview
NameCN188899
Unique NameCN188899
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length304
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5773 contig Csv1_Contig5773:964..1267. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBL1_ORYSJ (Ubiquitin-like protein 1 OS=Oryza sativa subsp. japonica GN=UBL1 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_WHEAT (Ubiquitin OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_TRYCR (Ubiquitin OS=Trypanosoma cruzi PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_SOYBN (Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLTU (Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLLC (Ubiquitin OS=Solanum lycopersicum GN=UBI3 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_PETCR (Ubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_PEA (Ubiquitin OS=Pisum sativum GN=PU1 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_ORYSJ (Ubiquitin OS=Oryza sativa subsp. japonica GN=UBQ1 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CN188899 vs. ExPASy Swiss-Prot
Match: UBIQ_NICSY (Ubiquitin OS=Nicotiana sylvestris GN=UBICEP52-7 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query:  187 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 303
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   38 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
The following BLAST results are available for this feature:
BLAST of CN188899 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 75
Match NameE-valueIdentityDescription
UBL1_ORYSJ2.250e-15100.00Ubiquitin-like protein 1 OS=Oryza sativa subsp. ja... [more]
UBIQ_WHEAT2.250e-15100.00Ubiquitin OS=Triticum aestivum PE=3 SV=1[more]
UBIQ_TRYCR2.250e-15100.00Ubiquitin OS=Trypanosoma cruzi PE=3 SV=1[more]
UBIQ_SOYBN2.250e-15100.00Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1[more]
UBIQ_SOLTU2.250e-15100.00Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1[more]
UBIQ_SOLLC2.250e-15100.00Ubiquitin OS=Solanum lycopersicum GN=UBI3 PE=3 SV=... [more]
UBIQ_PETCR2.250e-15100.00Ubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=3... [more]
UBIQ_PEA2.250e-15100.00Ubiquitin OS=Pisum sativum GN=PU1 PE=3 SV=1[more]
UBIQ_ORYSJ2.250e-15100.00Ubiquitin OS=Oryza sativa subsp. japonica GN=UBQ1 ... [more]
UBIQ_NICSY2.250e-15100.00Ubiquitin OS=Nicotiana sylvestris GN=UBICEP52-7 PE... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001A01_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188899 ID=CN188899|Name=CN188899|organism=Citrus sinensis|type=EST|length=304bp
TTTTTTTAAAACTAGTGCTTATATTATTATTACCAATAGAAAGAGGAAAT
TACGCCCAAGCGGCTGGCCATTACACAATTGTAATTACAAAATAATTAAA
GCAAAGCGCCCAATCCAACCTAATTAATTATTATTAGCGCCATCCAATCA
AACGCGGACACATCCACATTTATTTTTTTAGAAGTCACCACCACGGAGAC
GGAGGACAAGGTGGAGAGTGGACTCCTTTTGAATGTTGTAATCGGCGAGA
GTCCGGCCATCCTCGAGCTGCTTGCCGGCGAAGATGAGCCTCTGCTGGTC
CGGA
back to top