CN188897

Overview
NameCN188897
Unique NameCN188897
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2690 contig Csv1_Contig2690:401..1044. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188897 vs. ExPASy Swiss-Prot
Match: POP5_ARATH (Probable ribonuclease P/MRP protein subunit POP5 OS=Arabidopsis thaliana GN=EMB1687 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.231e-28
Identity = 62/105 (59.05%), Postives = 81/105 (77.14%), Query Frame = -1
Query:  330 GLASSLGSFQVKYVNPITKLCIIRASREDCQKVWSAMTMVRSIGNCLVLFNVLDLSGSIRACKNAALKCEEVKFEHYKLAVGARLSADVTQHMENCLEKIKILEH 644
            GL SSLGSFQVKYVNPITKLCI+R+SRE+ ++VW A+T+V+SIGNC V+ N+LD+SG IRAC++ ALKC++ KFE         LS +  + M   LEKIK+LE+
Sbjct:   51 GLGSSLGSFQVKYVNPITKLCIVRSSREEHRQVWLAITLVKSIGNCPVILNLLDISGCIRACRDTALKCDKEKFEQ----CSKSLSEEEIRQMNTSLEKIKLLEN 151          
The following BLAST results are available for this feature:
BLAST of CN188897 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
POP5_ARATH2.231e-2859.05Probable ribonuclease P/MRP protein subunit POP5 O... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P22_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188897 ID=CN188897|Name=CN188897|organism=Citrus sinensis|type=EST|length=644bp
CTTTTTTGTTTTTTTTTTTTTCCAACAAGAGAGGAAACAACCTAAATACT
CTAAATCATCTATTTGAACCAATTAAACAAAGTTTCTTGAGCTTTGATGG
TTGCTTACAAAGAGTTGCATCCTCATCAAGCCAAAATCACTACAATCAGC
AATTAAAGGTGAGATTATGATATTTCTACGAAAATAGAAAGAAAGTTAAA
AAAAAACGGTGGGAAAAAAAAGCTAAAAATGGTAAAAAGAAAGTCTGTGA
TTAATGGAGCAAGCTATTGTAGTTAAAAGAGAATATGAAAATCTACTACT
TAACCACTTACAAGGATAAGATATTTTCAGTGTTCCAAAATTTTGATCTT
CTCCAGACAGTTTTCCATGTGTTGAGTAACATCGGCTGAGAGACGTGCTC
CAACGGCAAGCTTATAATGTTCAAATTTCACCTCCTCACACTTCAATGCA
GCATTCTTACAGGCCCTGATGCTCCCACTTAGGTCCAGTACGTTAAATAG
AACCAGGCAATTTCCTATGCTTCTAACCATGGTCATTGCAGACCAAACCT
TCTGACAATCCTCCCTTGAGGCTCTGATGATACATAGCTTGGTGATGGGA
TTCACATACTTGACTTGGAATGATCCAAGCGAAGAAGCTAGACC
back to top