CN188893

Overview
NameCN188893
Unique NameCN188893
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length450
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188893_ssr150 microsatellite CN188893_ssr150:150..161. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CN188893 vs. ExPASy Swiss-Prot
Match: SCL8_ARATH (Scarecrow-like protein 8 OS=Arabidopsis thaliana GN=SCL8 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.217e-31
Identity = 64/92 (69.57%), Postives = 73/92 (79.35%), Query Frame = -3
Query:  170 KVEEGLSRKLANSVACEGRDRVERFEVFGKWRAPMGMAGFELKPMSQIIAESMRT*LSSGNRVNPGFPVKEENGGICFGWMGRTFPVVFAWR 445
            KVEEG+ RKL N+VACEG DR+ER EVFGKWR  M MAGFEL P+S+ IAESM+   S GNRV+PGF VKE+NGG+CFGWMGR   V  AWR
Sbjct:  552 KVEEGIGRKLVNAVACEGIDRIERCEVFGKWRMRMSMAGFELMPLSEKIAESMK---SRGNRVHPGFTVKEDNGGVCFGWMGRALTVASAWR 640          
BLAST of CN188893 vs. ExPASy Swiss-Prot
Match: CIGR2_ORYSJ (Chitin-inducible gibberellin-responsive protein 2 OS=Oryza sativa subsp. japonica GN=CIGR2 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.328e-13
Identity = 34/86 (39.53%), Postives = 52/86 (60.47%), Query Frame = -3
Query:  173 LSRKLANSVACEGRDRVERFEVFGKWRAPMGMAGFELKPMSQIIAESMRT*LSSGNRVNPGFPVKEENGGICFGWMGRTFPVVFAW 430
            L+R++ N +ACEG +R ER+E FGKW+A + MAGF   P+S ++  ++RT L S    +  + + E +G +  GW  R   V  AW
Sbjct:  461 LAREIVNLIACEGEERAERYEPFGKWKARLTMAGFRPSPLSSLVNATIRTLLQS---YSDNYKLAERDGALYLGWKSRPLVVSSAW 543          
BLAST of CN188893 vs. ExPASy Swiss-Prot
Match: SCL21_ARATH (Scarecrow-like protein 21 OS=Arabidopsis thaliana GN=SCL21 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 9.684e-13
Identity = 33/87 (37.93%), Postives = 53/87 (60.92%), Query Frame = -3
Query:  170 LSRKLANSVACEGRDRVERFEVFGKWRAPMGMAGFELKPMSQIIAESMRT*LSSGNRVNPGFPVKEENGGICFGWMGRTFPVVFAWR 430
            ++R + N +ACEG +R+ER E+ GKW++   MAGFE  P+S II+ ++R  L      + G+ ++E +G +  GWM R      AW+
Sbjct:  330 MARDVVNIIACEGAERIERHELLGKWKSRFSMAGFEPYPLSSIISATIRALLRD---YSNGYAIEERDGALYLGWMDRILVSSCAWK 413          
BLAST of CN188893 vs. ExPASy Swiss-Prot
Match: SCL1_ARATH (Scarecrow-like protein 1 OS=Arabidopsis thaliana GN=SCL1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.806e-12
Identity = 36/87 (41.38%), Postives = 52/87 (59.77%), Query Frame = -3
Query:  170 LSRKLANSVACEGRDRVERFEVFGKWRAPMGMAGFELKPMSQIIAESMRT*LSSGNRVNPGFPVKEENGGICFGWMGRTFPVVFAWR 430
            L+R + N VACEG +R+ER+E  GKWRA M MAGF  KPMS  +  +++  +    +    + +KEE G + F W  ++  V  AWR
Sbjct:  509 LARDIVNIVACEGEERIERYEAAGKWRARMMMAGFNPKPMSAKVTNNIQNLIK--QQYCNKYKLKEEMGELHFCWEEKSLIVASAWR 593          
BLAST of CN188893 vs. ExPASy Swiss-Prot
Match: PAT1_ARATH (Scarecrow-like transcription factor PAT1 OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.806e-12
Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = -3
Query:  170 LSRKLANSVACEGRDRVERFEVFGKWRAPMGMAGFELKPMSQIIAESMRT*LSSGNRVNPGFPVKEENGGICFGWMGRTFPVVFAWR 430
            L+R + N +ACEG DRVER E+ GKWR+  GMAGF   P+S ++  ++++ L      +  + ++E +G +  GWM R      AW+
Sbjct:  407 LARDVVNIIACEGADRVERHELLGKWRSRFGMAGFTPYPLSPLVNSTIKSLL---RNYSDKYRLEERDGALYLGWMHRDLVASCAWK 490          
The following BLAST results are available for this feature:
BLAST of CN188893 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
SCL8_ARATH1.217e-3169.57Scarecrow-like protein 8 OS=Arabidopsis thaliana G... [more]
CIGR2_ORYSJ3.328e-1339.53Chitin-inducible gibberellin-responsive protein 2 ... [more]
SCL21_ARATH9.684e-1337.93Scarecrow-like protein 21 OS=Arabidopsis thaliana ... [more]
SCL1_ARATH4.806e-1241.38Scarecrow-like protein 1 OS=Arabidopsis thaliana G... [more]
PAT1_ARATH4.806e-1237.93Scarecrow-like transcription factor PAT1 OS=Arabid... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188893 ID=CN188893|Name=CN188893|organism=Citrus sinensis|type=EST|length=450bp
TTTTTTTTTTTTTTTTTCTTTTTTTTTTTACAAAACGCTACCCCTTTATT
ATTATTTCCTTTAGGGGGCCTCTTTTTTTTTCTTTCCCTTTCCATTTTCC
CAGGAAAACGTTCGAAAATATAATAACAATTAAGAATATTAAATTAAAAA
GAGAGAGAGAGGGAATTCCACGCCAGGCAAAAACAACGGGGAAAGTTCGA
CCCATCCAGCCAAAGCAAATGCCGCCGTTTTCTTCTTTGACGGGGAACCC
CGGGTTCACTCGGTTCCCGGAACTCAGTCAAGTCCGCATTGACTCGGCAA
TGATTTGACTCATTGGTTTCAACTCGAACCCAGCCATCCCCATGGGGGCT
CGCCATTTGCCAAAAACCTCGAATCTCTCCACACGGTCCCTGCCTTCACA
AGCAACCGAGTTAGCCAATTTACGACTCAGCCCTTCCTCGACTTTGACTC
back to top