CN188880

Overview
NameCN188880
Unique NameCN188880
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length724
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188880_ssr101 microsatellite CN188880_ssr101:101..112. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: C86A2_ARATH (Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.917e-48
Identity = 88/159 (55.35%), Postives = 117/159 (73.58%), Query Frame = -3
Query:  189 EEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTAVKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLR--DGRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPKLALTMYMKHGLKVNLCKRDESELQK 659
            +E+ ++ YL+AALSE LRLYPSVP D K VV DD+ PDGT V  G+ V Y+IYA GRM++ WG+DC EFKPERW+   DG++ +   Y+F AFN GPR+CLGKD AY QMK  AA+++ R+R+ V  GH V  K++LT++MK+GL VN+ KRD   + K
Sbjct:  360 DEVDRLVYLKAALSETLRLYPSVPEDSKHVVNDDILPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFKPERWISPDDGKFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKMSLTLFMKNGLLVNVHKRDLEVMMK 518          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: C86A1_ARATH (Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 9.349e-45
Identity = 89/155 (57.42%), Postives = 114/155 (73.55%), Query Frame = -3
Query:  204 EEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTAVKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWL-RDGR--YTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPKLALTMYMKHGLKVNLCKRDE 659
            +E  ++ YL+AAL+E LRLYPSVP D K VV+DDV PDGT V +G+ V Y+IY++GRM+ IWG+DC EF+PERWL  DG    T +  YKF AFN GPR CLGKD AY QMK  A++++ RYRV  V GH V  K++LT++MK+GL+V L  R E
Sbjct:  356 DEADRLVYLKAALAETLRLYPSVPQDFKYVVDDDVLPDGTFVPRGSTVTYSIYSIGRMKTIWGEDCLEFRPERWLTADGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKMSLTLFMKNGLRVYLQPRGE 510          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: C04C1_PINTA (Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.969e-38
Identity = 79/155 (50.97%), Postives = 103/155 (66.45%), Query Frame = -3
Query:  198 EEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTAVKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPKLALTMYM-KHGLKVNLCKRDESE 659
            E + KM YL A+LSE LRLYP++PVD K VV +D  PDG  VKKG  V +  YAMGRM  +WG D +EFKPERW++DG +  +S +KF AF  GPR CLGKDFAY QMK  AA ++  ++ + VK   V  +  LT++M + GL V +  R  S+
Sbjct:  364 EALGKMHYLHASLSETLRLYPALPVDGKYVVNEDTLPDGFKVKKGDSVNFLPYAMGRMSYLWGDDAKEFKPERWIQDGIFHPKSPFKFPAFQAGPRTCLGKDFAYLQMKIVAAVLVRFFKFEAVKTKEVRYRTMLTLHMNEDGLNVQVTPRLNSD 518          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: C94A1_VICSA (Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 5.685e-34
Identity = 77/177 (43.50%), Postives = 105/177 (59.32%), Query Frame = -3
Query:  207 EDGKMKESSSNSLVFKPEEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTAVKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGR------YTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPK---LALTMYMKHGLKVNLCKRD 710
            E+  + E S  S +   +E+K+M Y  AALSE++RLYP VP+D KE V DDV PDG  VKKGT V Y +YAMGRM+++WG D  EF+PERWL          +    +Y +  F  GPR+CLGK+ A+ QMK   A I+ +++V V + H          L+  M+ G  V + KRD
Sbjct:  338 EEEIVNELSKKSELMVYDEVKEMVYTHAALSESMRLYPPVPMDSKEAVNDDVLPDGWVVKKGTIVTYHVYAMGRMKSLWGDDWAEFRPERWLEKDEVNGKWVFVGRDSYSYPVFQAGPRVCLGKEMAFMQMKRIVAGIVGKFKV-VPEAHLAQEPGFISFLSSQMEGGFPVTIQKRD 513          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: C94A2_VICSA (Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.685e-33
Identity = 79/174 (45.40%), Postives = 100/174 (57.47%), Query Frame = -3
Query:  210 EDGKMKESSSNSLVFKPEEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTAVKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWL-RD----GRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPKLA--LTMYMKHGLKVNLCKR 710
            E+  +KE +  S     +E+K M Y  AAL E++RLYP +PVD K  V DDV PDGT VKKG +V Y IYAMGR E IWG D  EF+PERWL RD      +     Y +  F  GPR+C+GK+ A+ QMK   A I+ R+RV       + P+     T  MK G  V + KR
Sbjct:  336 ENEILKEITGKSETVGYDEVKDMVYTHAALCESMRLYPPLPVDTKVAVHDDVLPDGTLVKKGWRVTYHIYAMGRSEKIWGPDWAEFRPERWLSRDEVGKWSFVGIDYYSYPVFQAGPRVCIGKEMAFLQMKRVVAGIMGRFRVVPAMVEGIEPEYTAHFTSVMKGGFPVKIEKR 509          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: CP52E_CANMA (Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.006e-22
Identity = 55/149 (36.91%), Postives = 79/149 (53.02%), Query Frame = -3
Query:  237 EEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFP-----DGTA---VKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPKLALTMYMKH 659
            E +KK +YL+A L+E LR+YPSVPV+ +    D   P     DGT+   V KG+ V+Y +Y   R+E  +GKD  EF+PERW      T +  + +  FNGGPR+CLG+ FA  +  Y    +   +     K     P   + + M H
Sbjct:  368 ETLKKCEYLKAVLNETLRMYPSVPVNFRTATRDTTLPRGGGKDGTSPIFVPKGSSVVYTVYKTHRLEEYYGKDAYEFRPERWFEPS--TRKLGWAYVPFNGGPRICLGQQFALTEASYVITRLAQMFEHLESKDETYPPNKCIHLTMNH 514          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: CP52C_CANMA (Cytochrome P450 52A3 OS=Candida maltosa GN=CYP52A3 PE=1 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 1.112e-21
Identity = 51/149 (34.23%), Postives = 78/149 (52.35%), Query Frame = -3
Query:  237 EEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTA--------VKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPKLALTMYMKH 659
            E +KK +YL+A L+E LR+YPSVP++ +    D   P G          V KG+ V+Y++Y   R++  +G+D  EF+PERW      T +  + +  FNGGPR+CLG+ FA  +  Y  A +   +     K     P   + + M H
Sbjct:  368 ETLKKCEYLKAVLNETLRMYPSVPINFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSVYKTHRLKQFYGEDAYEFRPERWFEPS--TRKLGWAYLPFNGGPRICLGQQFALTEASYVIARLAQMFEHLESKDETYPPNKCIHLTMNH 514          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: CP52M_DEBHA (Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.236e-21
Identity = 59/173 (34.10%), Postives = 93/173 (53.76%), Query Frame = -3
Query:  219 GKMKESSSNSLVFKPEEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTA--------VKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRY---RVKVVKGHPVSPKLALTMYMKHGLKVNL 704
            GK  ++  + + F  E +KK +YL+  ++E LRLYPSVPV+ +   +    P G          V KGT V Y++Y+  RME  +GKD  EFKPERW      + +  + +  FNGGPR+CLG+ FA  +  Y    ++  +    +   + +P +  + LTM  + G+ V+L
Sbjct:  352 GKGDDARVSEITF--ESLKKCEYLKWVMNEMLRLYPSVPVNFRVATKRTTLPRGGGPDGNSPIYVGKGTTVAYSVYSTHRMEEYYGKDADEFKPERWAE----SRKLGWAYVPFNGGPRICLGQQFALTEASYIVTRLLQMFDKLELHDDRPYPPAKSVHLTMCHQDGVYVSL 518          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: CP52W_CANAP (Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.097e-20
Identity = 53/137 (38.69%), Postives = 75/137 (54.74%), Query Frame = -3
Query:  276 EEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTA--------VKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRY-RVKVVKGHP 659
            E++K+   LQ  + E LRL+P+VP++ +E + D  FP G          V KG KV YA Y M R   IWG D   F+P+RW  + R    S + +  FNGGPR+CLG+ FA  +  Y    I   + R++V+  HP
Sbjct:  357 EQLKQCKVLQNVIREVLRLHPNVPLNFREAIADTTFPTGGGPNGDQPIFVPKGQKVFYATYVMQRNAGIWGPDSTSFRPDRW-NEPREALASGWDYIPFNGGPRICLGQQFALTEASYTLVRICQEFSRIEVL--HP 490          
BLAST of CN188880 vs. ExPASy Swiss-Prot
Match: CP52L_DEBHA (Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.097e-20
Identity = 59/170 (34.71%), Postives = 84/170 (49.41%), Query Frame = -3
Query:  219 GKMKESSSNSLVFKPEEIKKMDYLQAALSEALRLYPSVPVDHKEVVEDDVFPDGTA--------VKKGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGRYTSESAYKFTAFNGGPRLCLGKDFAYYQMKYAAASIIYRYRVKVVKGHPVSPKLALTMYMKHGLKVNL 704
            GK  ++    + F  E +KK +YL+A L+E LRLYPSVP + +   +D   P G          + KG  V Y +YAM R E  +GKD   F+PERW      T +  + F  FNGGPR+CLG+ FA  +  Y  A +   +           P+ A  + M H  +V +
Sbjct:  351 GKGDDARLEDITF--ESLKKCEYLKALLNEVLRLYPSVPQNFRVAQKDTSLPRGGGPNRDQPIFIAKGQTVTYTVYAMHRDEQFYGKDSEVFRPERWFEP--ETRKLGWAFLPFNGGPRICLGQQFALTEASYVIARLAQLFPNLASHDDEYPPRKASHLTMCHQSEVKI 516          
The following BLAST results are available for this feature:
BLAST of CN188880 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
C86A2_ARATH6.917e-4855.35Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CY... [more]
C86A1_ARATH9.349e-4557.42Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CY... [more]
C04C1_PINTA4.969e-3850.97Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 P... [more]
C94A1_VICSA5.685e-3443.50Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE... [more]
C94A2_VICSA3.685e-3345.40Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE... [more]
CP52E_CANMA1.006e-2236.91Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5... [more]
CP52C_CANMA1.112e-2134.23Cytochrome P450 52A3 OS=Candida maltosa GN=CYP52A3... [more]
CP52M_DEBHA3.236e-2134.10Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=... [more]
CP52W_CANAP2.097e-2038.69Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2... [more]
CP52L_DEBHA2.097e-2034.71Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P06_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188880 ID=CN188880|Name=CN188880|organism=Citrus sinensis|type=EST|length=724bp
TTTTTTTTTTTTTTTTTATTAAATACAACCCTTTATATTCCCATTTAAAT
TATGTTTCAATCAATTCCATGTATTTCTAACACATATATATTGCAATACC
AATAATAATAATATGGCTAAAAATTATGAAAAGCAAACATATTTTATTGA
CACAAAGTGAGCTCTCAATTTATCATTCACTTGAAGTATTTTTGCAGCTC
AGACTCATCTCGCTTGCATAGGTTCACCTTCAAGCCATGCTTCATGTACA
TTGTCAACGCAAGCTTTGGTGACACCGGATGACCCTTCACCACCTTAACA
CGGTAGCGGTAAATGATGGAGGCGGCAGCGTATTTCATCTGATAGTAGGC
GAAATCTTTGCCGAGGCAGAGCCTGGGGCCACCGTTGAAGGCAGTGAACT
TGTAGGCTGATTCACTCGTATAACGGCCGTCTCTTAGCCATCTTTCTGGC
TTGAATTCTCTACAATCCTTTCCCCATATTGCCTCCATTCTTCCCATTGC
ATAAATTGCATATATCACTTTTGTTCCCTTCTTTACAGCTGTCCCATCTG
GAAATACATCGTCTTCAACCACCTCTTTGTGATCAACAGGCACAGAGGGA
TACAACCTCAAAGCCTCTGATAATGCAGCTTGCAAATAATCCATTTTTTT
AATCTCCTCAGGCTTAAACACCAATGAATTACTGCTACTCTCCTTCATTT
TCCCGTCTTCTCTTTCAGCAATTA
back to top