CN182050
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN182050 vs. ExPASy Swiss-Prot
Match: ADK2_ARATH (Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 5.316e-14 Identity = 31/40 (77.50%), Postives = 38/40 (95.00%), Query Frame = -1 Query: 318 FLSQLVQEKPVEDCVRAGCYAANVVIQRSGCTYPPKPEFN 437 F+SQLV+EK +E+CV+AGCYA+NVVIQRSGCTYP KP+FN Sbjct: 306 FMSQLVKEKSIEECVKAGCYASNVVIQRSGCTYPEKPDFN 345 HSP 2 Score: 23.483 bits (49), Expect = 5.316e-14 Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = -3 Query: 475 FPVILLPKEKLV 510 +PVI LPKEKLV Sbjct: 282 YPVIPLPKEKLV 293
BLAST of CN182050 vs. ExPASy Swiss-Prot
Match: ADK1_ARATH (Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 1.514e-13 Identity = 32/40 (80.00%), Postives = 36/40 (90.00%), Query Frame = -1 Query: 318 FLSQLVQEKPVEDCVRAGCYAANVVIQRSGCTYPPKPEFN 437 FLSQLV K +E+CVRAGCYA+NVVIQRSGCTYP KP+FN Sbjct: 305 FLSQLVHGKGIEECVRAGCYASNVVIQRSGCTYPEKPDFN 344 HSP 2 Score: 23.483 bits (49), Expect = 1.514e-13 Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = -3 Query: 475 FPVILLPKEKLV 510 +PVI LPKEKLV Sbjct: 281 YPVIPLPKEKLV 292 The following BLAST results are available for this feature:
BLAST of CN182050 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN182050 ID=CN182050; Name=CN182050; organism=Citrus sinensis; type=EST; length=515bpback to top |