CN188821

Overview
NameCN188821
Unique NameCN188821
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length757
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_CAEEL (Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.298e-31
Identity = 73/170 (42.94%), Postives = 105/170 (61.76%), Query Frame = -1
Query:  248 QPMLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEVSSSQIRSSPAKQKTLDSFLKRCNNVDDSEHQQKLKYRK 757
            Q +LD I     K+K+  IRIDG TP   R AL   FQ  D+++ AVLS+ A GVG+TLTAAS V+FAE+ + PG L+QAEDRAHR+GQ  SV V YL+A  T DD++W++V+ KL+ LGQV    +         +R + A Q  +  +LK+  +    E +  ++ ++
Sbjct:  503 QIVLDTIQVEVNKRKLGSIRIDGKTPSHRRTALCDSFQTDDNIRVAVLSITAAGVGITLTAASVVVFAEIHFNPGYLVQAEDRAHRVGQKDSVFVQYLIAKKTADDVMWNMVQQKLDVLGQVSLSSDTFRTADKMHLRFNDAAQPGIAEYLKKTPDTTIDEWEDPVEEKE 672          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: ZRAB3_MOUSE (Zinc finger Ran-binding domain-containing protein 3 OS=Mus musculus GN=Zranb3 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.215e-29
Identity = 63/131 (48.09%), Postives = 88/131 (67.18%), Query Frame = -1
Query:  359 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEVS 751
            ML A  +  ++ K   IRIDG  P + R  LV +FQ+  D + A+LS++A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SSVN++YL+AN T+D ++W ++  K +  G  L+G +  L+ +
Sbjct:  350 MLQACTEAVIESKSRYIRIDGSVPSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQAT 480          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: ZRAB3_HUMAN (Zinc finger Ran-binding domain-containing protein 3 OS=Homo sapiens GN=ZRANB3 PE=2 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.343e-28
Identity = 61/129 (47.29%), Postives = 86/129 (66.67%), Query Frame = -1
Query:  365 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLE 751
            ML A  +  ++ K   IRIDG    + R  LV +FQ+  D + A+LS++A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SSVN++YL+AN T+D ++W ++  K +  G  L+G +  ++
Sbjct:  350 MLQACTEAVIENKTRYIRIDGSVSSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQ 478          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_XENTR (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.292e-28
Identity = 72/160 (45.00%), Postives = 98/160 (61.25%), Query Frame = -1
Query:  275 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEVS-SSQIRSSPAKQKTLDSFLKRCNNVDDSE 751
            +LD I +   KK V  IRIDG T  A RQ+L  +FQ  +    AVLS+ A  +GLTL++A  V+FAEL W PG LIQAEDR HRIGQ SSVN++YL+A  T DD +W +++ K++ LGQ      N  E + S+       KQKT+    +R  + + +E
Sbjct:  740 VLDHICEELGKKDVPYIRIDGNTSSADRQSLCHKFQMSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANFSETTESTDYFYKDPKQKTIYDLFQRSFSEEGAE 899          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_XENLA (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.292e-28
Identity = 72/161 (44.72%), Postives = 99/161 (61.49%), Query Frame = -1
Query:  272 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEVS-SSQIRSSPAKQKTLDSFLKRCNNVDDSEH 751
            +LD I +   KK+V  IRIDG T  A RQ+L  +FQ  +    AVLS+ A  +GLTL++A  V+FAEL W PG LIQAEDR HRIGQ SSVN++YL+A  T DD +W +++ K++ LGQ      N  E + S+       KQKT+    +R  +   +E+
Sbjct:  758 VLDNICEELGKKEVPYIRIDGNTSSADRQSLCHKFQFSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANFSETTESTDYFYKDPKQKTIYDLFQRSFSEQGAEN 918          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_DANRE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.909e-28
Identity = 69/158 (43.67%), Postives = 95/158 (60.13%), Query Frame = -1
Query:  281 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQV-LDGHENSLEVSSSQIRSSPAKQKTLDSFLKRCNNVDD 751
            +LD+I K   +K +  IRIDG TP A RQ L   FQ       AVLS+ A  +GLTL +A+ V+FAEL W PG LIQAEDR HRIGQ S+V+++YL+A  T DD +W ++++K+  L QV L     S    S+   S   +Q T+    +R  + D+
Sbjct:  641 VLDSITKELGEKSISFIRIDGSTPSAERQLLCERFQASQQSCVAVLSITAANMGLTLHSAALVVFAELFWNPGVLIQAEDRVHRIGQTSNVDIHYLVAKGTADDYLWPMIQAKMNVLEQVGLSESNISENAESASFHSRDRQQLTITEMFQRSFDEDE 798          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_RAT (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 8.708e-28
Identity = 68/160 (42.50%), Postives = 97/160 (60.62%), Query Frame = -1
Query:  275 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEVS-SSQIRSSPAKQKTLDSFLKRCNNVDDSE 751
            +LDAI K   +K V  IRIDG TP A R+ L  +FQ       AVLS+ A  +GLT ++A  V+FAEL W PG LIQAEDR HRIGQ +SV ++YL+A  T DD +W +++ K++ LG+      N  E++ ++       KQKT+ S  ++    D ++
Sbjct:  693 LLDAIAKELERKNVQHIRIDGSTPSADREDLCQQFQLSKGHTVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVGIHYLVAKGTADDYLWPLIQEKIKVLGEAGLSETNFSEMTEATDYLYKDPKQKTIYSLFQQSFEDDGND 852          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_HUMAN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.322e-27
Identity = 67/152 (44.08%), Postives = 92/152 (60.53%), Query Frame = -1
Query:  302 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEV--SSSQIRSSPAKQKTLDSFLK 751
            +LDAI +   +K V  IRIDG T  A R+ L  +FQ  +    AVLS+ A  +GLT ++A  V+FAEL W PG LIQAEDR HRIGQ SSV ++YL+A  T DD +W +++ K++ L +      N  E+  S+  +   P +QK  D F K
Sbjct:  737 VLDAITQELERKHVQHIRIDGSTSSAEREDLCQQFQLSERHAVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNFSEMTESTDYLYKDPKQQKIYDLFQK 888          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_MOUSE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 9.628e-27
Identity = 65/147 (44.22%), Postives = 91/147 (61.90%), Query Frame = -1
Query:  317 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEV--SSSQIRSSPAKQKTL 751
            +LDA+ K   +K V  IRIDG TP A R+A    FQ       A+LS+ A  +GLT + A  V+FAEL W PG LIQAEDR HRIGQ +SV+++YL+A  T DD +W +++ K++ LG+      N  E+  ++  +   P KQKT+
Sbjct:  695 ILDAVAKELERKNVQHIRIDGSTPSADREAQCQRFQLSKGHTVALLSITAANMGLTFSTADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVSIHYLVAKGTADDYLWPLIQEKIKVLGEAGLSETNFSEMTEATDYVHKDP-KQKTI 840          
BLAST of CN188821 vs. ExPASy Swiss-Prot
Match: SMAL1_DROME (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 2.371e-25
Identity = 60/120 (50.00%), Postives = 77/120 (64.17%), Query Frame = -1
Query:  392 MLDAIHKLFLKKKVHCIRIDGGTPPASRQALVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVYYLLANDTVDDIVWDVVRSKLENLGQV 751
            M+DAI       KVH IRIDG T    R   V  FQ+K   K A+LS+KA   G+TLTAA  ++FAEL W P  L QAE RAHRIGQ   V   YL+A++T DDI+W+++++K E L +V
Sbjct:  547 MMDAISDFLSGLKVHYIRIDGQTRSDHRSDSVDTFQKKSSCKVALLSLKACNSGITLTAAEIIVFAELDWNPSTLAQAESRAHRIGQTKPVICRYLIAHNTADDIIWNMLKNKQEVLSKV 666          
The following BLAST results are available for this feature:
BLAST of CN188821 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
SMAL1_CAEEL1.298e-3142.94Putative SMARCAL1-like protein OS=Caenorhabditis e... [more]
ZRAB3_MOUSE1.215e-2948.09Zinc finger Ran-binding domain-containing protein ... [more]
ZRAB3_HUMAN1.343e-2847.29Zinc finger Ran-binding domain-containing protein ... [more]
SMAL1_XENTR2.292e-2845.00SWI/SNF-related matrix-associated actin-dependent ... [more]
SMAL1_XENLA2.292e-2844.72SWI/SNF-related matrix-associated actin-dependent ... [more]
SMAL1_DANRE3.909e-2843.67SWI/SNF-related matrix-associated actin-dependent ... [more]
SMAL1_RAT8.708e-2842.50SWI/SNF-related matrix-associated actin-dependent ... [more]
SMAL1_HUMAN4.322e-2744.08SWI/SNF-related matrix-associated actin-dependent ... [more]
SMAL1_MOUSE9.628e-2744.22SWI/SNF-related matrix-associated actin-dependent ... [more]
SMAL1_DROME2.371e-2550.00SWI/SNF-related matrix-associated actin-dependent ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006N06_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006N06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188821 ID=CN188821|Name=CN188821|organism=Citrus sinensis|type=EST|length=757bp
CTTTTTTTATAAACGATGTTATTGTATTCATCTACAAAACAGAGGAATAT
CCCTATAAAGCCTCATGTCAGTATTACACTTACACTGCCTGTCATATAGA
GATTCTTGTCTCTCACTAATTTGGAGTAGTAATCAATGTTCTCTGAGGCT
CCGCATATCAAAAGGGCACATTTTCATGTGTCTGTGTACATGTGATGCAT
AGACCGACGCATCTCAAAATATACATTTTATAGTGTGTGGATTAGAGCTT
TCGGTATTTTAGCTTCTGCTGATGTTCAGAGTCATCCACATTGTTGCAAC
GCTTCAGGAAGGAGTCGAGTGTTTTCTGCTTTGCAGGGCTGCTTCTTATT
TGACTGCTTGAAACTTCCAAACTATTTTCATGACCATCAAGCACCTGTCC
CAAATTTTCCAACTTGCTCCGAACAACATCCCATACTATGTCATCAACTG
TGTCATTTGCCAGTAGGTAGTATACATTTACGGAAGATACCTGGCCGATC
CTGTGAGCACGATCTTCAGCTTGAATGAGATCACCTGGAGTCCATGACAA
CTCCGCGAAAATAACAGTGCTTGCAGCCGTTAATGTTAAACCAACACCTC
CGGCTTTCATAGATAGCACTGCTGCCTTGACATCATCTTTCTCCTGAAAT
TCAGTAACCAAAGCTTGTCTTGAAGCAGGAGGGGTACCCCCATCAATCCG
AATGCAATGCACTTTCTTCTTAAGAAAAAGTTTATGTATTGCATCAAGCA
TGGGCTG
back to top