CN188816

Overview
NameCN188816
Unique NameCN188816
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length700
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2627 contig Csv1_Contig2627:213..910. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188816 vs. ExPASy Swiss-Prot
Match: SKIP2_ARATH (F-box protein SKIP2 OS=Arabidopsis thaliana GN=SKIP2 PE=1 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 7.019e-74
Identity = 142/222 (63.96%), Postives = 177/222 (79.73%), Query Frame = 2
Query:   50 MGQTPSTAIDPSDR---FNILSPAIVSN-DGVEFSDELDKARDFTGDLPDDCLAYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPSVFSRFDSVTKLALRCDRKSISLDDDALVLISLRCQKLTRLKLRGCREITDHGMVAFAQNCKTLKKLSCGSCMFGAKAINSVLDHCELLEELSIKRLRGIHDGADPIQ-PGAAAALSLKSICL 700
            MGQ PS+  + + R     + SP IV+  + +   + +D  RDFTGDLPD+CLA++FQFLG+GDRKRCSLVCKRWL VDG SR+RLSL+A+ EI S L S+F+RFDSVTKLALRCDRKS+SL D+AL +IS+RC  LTR+KLRGCREITD GM  FA+NCK LKKLS GSC FGAK +N++L+HC+LLEELS+KRLRGIH+ A+ I  P  A++ SL+SICL
Sbjct:    1 MGQAPSSTAESNGRELDLRLWSPVIVAGGESMAVGNVVD--RDFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLLVDGQSRHRLSLDAKDEISSFLTSMFNRFDSVTKLALRCDRKSVSLSDEALAMISVRCLNLTRVKLRGCREITDLGMEDFAKNCKNLKKLSVGSCNFGAKGVNAMLEHCKLLEELSVKRLRGIHEAAELIHLPDDASSSSLRSICL 220          
BLAST of CN188816 vs. ExPASy Swiss-Prot
Match: FBL16_ARATH (F-box/LRR-repeat protein 16 OS=Arabidopsis thaliana GN=FBL16 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 6.149e-70
Identity = 133/220 (60.45%), Postives = 172/220 (78.18%), Query Frame = 2
Query:   50 MGQTPSTAIDPSDRFNIL---SPAIVSNDGVEFSDELDKARDFTGDLPDDCLAYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPSVFSRFDSVTKLALRCDRKSISLDDDALVLISLRCQKLTRLKLRGCREITDHGMVAFAQNCKTLKKLSCGSCMFGAKAINSVLDHCELLEELSIKRLRGIHDGADPIQPGAAAALSLKSICL 700
            MGQ PS+  +P+ R   L   SP  +  + + F D      DFT +LPDDCLA+IFQFL +GDRKRCSLV KRWL VDG +R+RLSL+A+SEIL  LP +F+RFDSVTKLALRCDR+S SL D+AL ++S+RC  L R+KLRGCREITD GM +FA+NCK+L+KLSCGSC FGAK IN++L+HC++LEELS+KR+RG+H+ A+PI+   +A  SL+S+ L
Sbjct:    1 MGQAPSSPAEPNVRDTSLCLWSPEFLDCESIGFEDG---DYDFTANLPDDCLAHIFQFLSAGDRKRCSLVSKRWLLVDGQNRHRLSLDAKSEILPFLPCIFNRFDSVTKLALRCDRRSFSLSDEALFIVSIRCSNLIRVKLRGCREITDLGMESFARNCKSLRKLSCGSCTFGAKGINAMLEHCKVLEELSLKRIRGLHELAEPIKLSLSA--SLRSVFL 215          
BLAST of CN188816 vs. ExPASy Swiss-Prot
Match: FB37_ARATH (F-box protein At1g47056 OS=Arabidopsis thaliana GN=At1g47056 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.560e-65
Identity = 121/180 (67.22%), Postives = 151/180 (83.89%), Query Frame = 2
Query:  164 DFTGDLPDDCLAYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPSVFSRFDSVTKLALRCDRKSISLDDDALVLISLRCQKLTRLKLRGCREITDHGMVAFAQNCKTLKKLSCGSCMFGAKAINSVLDHCELLEELSIKRLRGIHDGA-DPIQPGAAAALSLKSICL 700
            D+T  LPD+CLA +FQFL SG+RKRC+LVC+RW+ V+G +RYRLSL+A+S++++S+PS+FSRFDSVTKL+L+CDR+S+S+ D+ALV ISLRC+ L RLKLR CRE+TD GM AFA+NCK LK  SCGSC FGAK + +VLDHC  LEELSIKRLRG  D A + I PG AA+ SLKSICL
Sbjct:   38 DYTSSLPDECLALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSIPSLFSRFDSVTKLSLKCDRRSVSIGDEALVKISLRCRNLKRLKLRACRELTDVGMAAFAENCKDLKIFSCGSCDFGAKGVKAVLDHCSNLEELSIKRLRGFTDIAPEMIGPGVAAS-SLKSICL 216          
BLAST of CN188816 vs. ExPASy Swiss-Prot
Match: FBL8_ARATH (Putative F-box/LRR-repeat protein 8 OS=Arabidopsis thaliana GN=FBL8 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 7.796e-57
Identity = 108/183 (59.02%), Postives = 143/183 (78.14%), Query Frame = 2
Query:  152 DKARDFTGDLPDDCLAYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPSVFSRFDSVTKLALRCDRKSISLDDDALVLISLRCQKLTRLKLRGCREITDHGMVAFAQNCKTLKKLSCGSCMFGAKAINSVLDHCELLEELSIKRLRGIHDGADPIQPGAAAALSLKSICL 700
            D+  D+  +LPD+CL+ IFQ L   D KRCSLVC+RWL ++G  R+RLSL AQS+++S +PS+F+RFDSVTKL LR DR+S+ + D+A V+IS+RC+ LTRLKLRGC EI+D G++ F +NC++LKK+S GSC FG K +N++L+ C  LEELS+KRLRGI  GA+ I PG AA  SLK ICL
Sbjct:   68 DEPYDYISNLPDECLSLIFQSLTCADLKRCSLVCRRWLTIEGQCRHRLSLKAQSDLISVIPSLFTRFDSVTKLVLRSDRRSLGICDNAFVMISVRCRNLTRLKLRGCPEISDLGIIGFTENCRSLKKVSFGSCGFGVKGMNALLNTCLGLEELSVKRLRGIGAGAELIGPGGAAG-SLKVICL 249          
The following BLAST results are available for this feature:
BLAST of CN188816 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SKIP2_ARATH7.019e-7463.96F-box protein SKIP2 OS=Arabidopsis thaliana GN=SKI... [more]
FBL16_ARATH6.149e-7060.45F-box/LRR-repeat protein 16 OS=Arabidopsis thalian... [more]
FB37_ARATH4.560e-6567.22F-box protein At1g47056 OS=Arabidopsis thaliana GN... [more]
FBL8_ARATH7.796e-5759.02Putative F-box/LRR-repeat protein 8 OS=Arabidopsis... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006M24_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006M24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188816 ID=CN188816|Name=CN188816|organism=Citrus sinensis|type=EST|length=700bp
GCTTTAAGATCCCTCTCGTTTTTGTTGTGCGAAACTATTTTGTTCGCCGA
TGGGCCAAACACCTTCAACGGCGATAGACCCGAGCGATCGGTTTAATATC
TTATCTCCGGCGATCGTTTCCAATGATGGTGTTGAGTTCTCCGACGAATT
GGACAAGGCTCGGGATTTCACAGGCGATTTACCGGACGATTGTTTGGCAT
ATATTTTTCAATTCCTCGGTTCAGGAGATCGGAAGCGATGTTCCCTTGTG
TGCAAACGGTGGCTCCGCGTGGACGGCGGGAGTCGTTATCGGCTATCTCT
CAATGCTCAGAGCGAGATATTATCGTCTCTGCCTTCGGTTTTCTCGCGCT
TCGACTCCGTCACGAAGCTAGCTCTGCGATGCGACCGCAAATCGATTAGC
TTAGACGACGACGCTTTGGTTTTGATCTCTCTTCGTTGTCAGAAACTCAC
GCGCCTCAAGCTCCGTGGTTGCCGCGAGATCACCGATCACGGTATGGTCG
CATTTGCTCAAAATTGCAAAACTCTGAAAAAACTTTCTTGCGGCTCGTGT
ATGTTTGGCGCCAAAGCTATCAATTCGGTTCTTGATCACTGTGAGCTTCT
CGAGGAGCTATCCATCAAGCGGCTCAGAGGAATCCACGACGGAGCGGATC
CGATCCAGCCTGGAGCCGCTGCCGCTTTGTCCCTGAAGTCAATCTGCCTG
back to top