CN188815

Overview
NameCN188815
Unique NameCN188815
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length702
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2135 contig Csv1_Contig2135:62..764. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP1_DAUCA (Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.797e-35
Identity = 70/82 (85.37%), Postives = 76/82 (92.68%), Query Frame = -1
Query:  433 ADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 678
            A+VE+RCFVGGLAWAT D SL +AFS +GDI +SKIINDRETGRSRGFGFVTF+DEKSMRDAIEGMNGQ LDGRNITVNEAQ
Sbjct:    2 AEVEYRCFVGGLAWATNDESLEQAFSQFGDITDSKIINDRETGRSRGFGFVTFKDEKSMRDAIEGMNGQELDGRNITVNEAQ 83          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP1_SINAL (Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.105e-34
Identity = 69/84 (82.14%), Postives = 78/84 (92.86%), Query Frame = -1
Query:  433 ASADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 684
            AS DVE+RCFVGGLAWAT D +L  AFS YG++L+SKIINDRETGRSRGFGFVTF+DEKSM+DAIEGMNGQ+LDGR+ITVNEAQ
Sbjct:    2 ASPDVEYRCFVGGLAWATDDRALETAFSQYGEVLDSKIINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQDLDGRSITVNEAQ 85          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP7_ARATH (Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=GRP7 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.461e-34
Identity = 67/84 (79.76%), Postives = 78/84 (92.86%), Query Frame = -1
Query:  433 ASADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 684
            AS DVE+RCFVGGLAWAT D +L  AF+ YGD+++SKIINDRETGRSRGFGFVTF+DEK+M+DAIEGMNGQ+LDGR+ITVNEAQ
Sbjct:    2 ASGDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQ 85          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP2_SINAL (Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.221e-33
Identity = 67/84 (79.76%), Postives = 78/84 (92.86%), Query Frame = -1
Query:  433 ASADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 684
            AS DVE+RCFVGGLAWAT + SL  AFS +G++++SKIINDRETGRSRGFGFVTF+DEKSM+DAIEGMNGQ+LDGR+ITVNEAQ
Sbjct:    2 ASPDVEYRCFVGGLAWATDERSLETAFSQFGELVDSKIINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQDLDGRSITVNEAQ 85          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP_HORVU (Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.326e-31
Identity = 63/82 (76.83%), Postives = 71/82 (86.59%), Query Frame = -1
Query:  433 ADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 678
            ADVE+RCFVGGL WAT D SL  AFS YGD+++SKII DRETGRSRGFGFVTF  +++MR AIE MNGQ+LDGRNITVNEAQ
Sbjct:    2 ADVEYRCFVGGLRWATDDQSLQNAFSKYGDVIDSKIITDRETGRSRGFGFVTFASDEAMRQAIEAMNGQDLDGRNITVNEAQ 83          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRPA_MAIZE (Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.326e-31
Identity = 63/84 (75.00%), Postives = 74/84 (88.10%), Query Frame = -1
Query:  433 ASADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 684
            A+ADVE+RCFVGGLAWAT++ SL  AF++YG+IL+SK+I DRETGRSRGFGFVTF  E SM DAIE MNG+ LDGRNITVN+AQ
Sbjct:    2 AAADVEYRCFVGGLAWATSNESLENAFASYGEILDSKVITDRETGRSRGFGFVTFSSENSMLDAIENMNGKELDGRNITVNQAQ 85          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP8_ARATH (Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=GRP8 PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.264e-30
Identity = 61/82 (74.39%), Postives = 72/82 (87.80%), Query Frame = -1
Query:  433 ADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 678
            ++VE+RCFVGGLAWAT D  L   FS +GD+++SKIINDRE+GRSRGFGFVTF+DEK+MRDAIE MNG+ LDGR ITVNEAQ
Sbjct:    2 SEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP10_BRANA (Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.651e-30
Identity = 60/82 (73.17%), Postives = 73/82 (89.02%), Query Frame = -1
Query:  433 ADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 678
            ++VE+RCFVGGLAWAT D+ L   FS +G++++SKIINDRETGRSRGFGFVTF+DEKSM+DAI+ MNG+ LDGR ITVNEAQ
Sbjct:    2 SEVEYRCFVGGLAWATGDAELERTFSQFGEVIDSKIINDRETGRSRGFGFVTFKDEKSMKDAIDEMNGKELDGRTITVNEAQ 83          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP2_SORBI (Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.070e-29
Identity = 59/84 (70.24%), Postives = 73/84 (86.90%), Query Frame = -1
Query:  433 ASADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 684
            A+ADVE+RCFVGGLAWAT + +L +AF+ +G +++SK+I DRETGRSRGFGFVTF  E+SM DAIE MNG+ LDGRNITVN+AQ
Sbjct:    2 AAADVEYRCFVGGLAWATNNETLEQAFANFGQVIDSKVITDRETGRSRGFGFVTFSSEQSMLDAIENMNGKELDGRNITVNQAQ 85          
BLAST of CN188815 vs. ExPASy Swiss-Prot
Match: GRP1_SORBI (Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.401e-21
Identity = 50/64 (78.12%), Postives = 56/64 (87.50%), Query Frame = -1
Query:  433 SSLHEAFSAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQNLDGRNITVNEAQ 624
            +SLH AFS YG++LESKII DRET RSRGFGFVTF  E++MR AIEGMNG+ LDGRNITVNEAQ
Sbjct:    1 NSLHSAFSTYGEVLESKIILDRETQRSRGFGFVTFSTEEAMRSAIEGMNGKELDGRNITVNEAQ 64          
The following BLAST results are available for this feature:
BLAST of CN188815 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
GRP1_DAUCA3.797e-3585.37Glycine-rich RNA-binding protein OS=Daucus carota ... [more]
GRP1_SINAL1.105e-3482.14Glycine-rich RNA-binding protein GRP1A OS=Sinapis ... [more]
GRP7_ARATH2.461e-3479.76Glycine-rich RNA-binding protein 7 OS=Arabidopsis ... [more]
GRP2_SINAL1.221e-3379.76Glycine-rich RNA-binding protein GRP2A OS=Sinapis ... [more]
GRP_HORVU3.326e-3176.83Glycine-rich RNA-binding protein blt801 OS=Hordeum... [more]
GRPA_MAIZE3.326e-3175.00Glycine-rich RNA-binding, abscisic acid-inducible ... [more]
GRP8_ARATH1.264e-3074.39Glycine-rich RNA-binding protein 8 OS=Arabidopsis ... [more]
GRP10_BRANA1.651e-3073.17Glycine-rich RNA-binding protein 10 OS=Brassica na... [more]
GRP2_SORBI1.070e-2970.24Glycine-rich RNA-binding protein 2 OS=Sorghum bico... [more]
GRP1_SORBI1.401e-2178.13Glycine-rich RNA-binding protein 1 (Fragment) OS=S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006M24_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006M24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188815 ID=CN188815|Name=CN188815|organism=Citrus sinensis|type=EST|length=702bp
TTTTTTTTTTTTTTTTTGAAAAGAACTGTAATTCATTTCCTTTTTTTTTT
CAACAATTAACCAAACAGGGAGAACGAAACAACACAGGATAACAGGAACC
GATCAAAACGACACATCATAACCCAAGGAAAATATCAAAACACGGAACGG
TAACCTTCAACTCCTAATTTATCCTACAAAACCCTAGTTCCTCCAGCTAC
CGCCATCAAAAGCACCGCTCCTTGAGTATCGGGAACCACCATCACCGCCA
TATCCACCGTCACGGCTGTAACCACCTTCACGGCGGCCACCATATCCACC
GCCGCCACCTCCGTATCCGCGGCTCCCACCGTATCCACCGCCACCACCAC
TTTCACGGCGTCCACCACCTCCATATCCACCACCGCCACGGCTTCCGTAA
CCGCCACCGGCACCGCCACCGCTTCCACGGGACTGGGCCTCGTTGACTGT
TATGTTACGGCCGTCCAAATTCTGGCCGTTCATGCCTTCGATTGCGTCCC
TCATCGACTTCTCATCGCGGAAGGTAACGAATCCAAATCCTCTGGATCTT
CCAGTCTCGCGATCGTTAATAATCTTCGATTCAAGGATATCGCCGTAAGC
ACTGAAGGCCTCATGGAGAGAGCTGTCAGTGGTGGCCCAGGCCAGGCCGC
CTACGAAGCACCGAAACTCGACATCGGCTGAAGCCCTTAGGAGAAAACTT
GA
back to top