CN188809

Overview
NameCN188809
Unique NameCN188809
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length813
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9120 contig Csv1_Contig9120:117..928. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT61_ARATH (VAMP-like protein YKT61 OS=Arabidopsis thaliana GN=YKT61 PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.810e-98
Identity = 173/199 (86.93%), Postives = 186/199 (93.47%), Query Frame = -1
Query:  199 MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCAMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 795
            MKITALLVLKC P+ SDPV+L+ A DVSHFGYFQRSSVKEF++FV RTV  RTPP QRQSVQHEEYKVH+YNRNGLCA+GFMDDHYPVRS+FSLLNQVLDEYQK+FGESWR+A+ D+ QPWPYL EALNK+QDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLS ASQMFYKQAKKTN CCTIL
Sbjct:    1 MKITALLVLKCAPEASDPVILSNASDVSHFGYFQRSSVKEFVVFVGRTVASRTPPSQRQSVQHEEYKVHAYNRNGLCAVGFMDDHYPVRSAFSLLNQVLDEYQKSFGESWRSAKEDSNQPWPYLTEALNKFQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSMASQMFYKQAKKTNSCCTIL 199          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT62_ARATH (VAMP-like protein YKT62 OS=Arabidopsis thaliana GN=YKT62 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.645e-83
Identity = 151/201 (75.12%), Postives = 176/201 (87.56%), Query Frame = -1
Query:  199 MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQ--RSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCAMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 795
            MKITALLVLKC+P+  +PV+LA   D+S FG F   RS+ +EFI+F+ARTV +RTPPGQRQSV+HEEYKVH+YN NGLCA+GFMDDHYPVRS+FSLLNQVLD YQK++G++WR   +   QPWPYL EA +K++DPAEADKLLKIQRELDETKIILHKTID VLARGEKLDSLVEKSS+LS AS+MFYKQAKKTN CCT+L
Sbjct:    1 MKITALLVLKCDPETREPVILANVSDLSQFGKFSFYRSNFEEFIVFIARTVARRTPPGQRQSVKHEEYKVHAYNINGLCAVGFMDDHYPVRSAFSLLNQVLDVYQKDYGDTWRFENSS--QPWPYLKEASDKFRDPAEADKLLKIQRELDETKIILHKTIDGVLARGEKLDSLVEKSSELSLASKMFYKQAKKTNSCCTLL 199          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_ASHGO (Synaptobrevin homolog YKT6 OS=Ashbya gossypii GN=YKT6 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.455e-47
Identity = 101/202 (50.00%), Postives = 140/202 (69.31%), Query Frame = -1
Query:  199 MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRN-GLCAMGFMDDHYPVRSSFSLLNQVLDEYQKNFGES-WRT-AQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 795
            MKI ++ +L+ +  G+  + L +A D+S FG+F+R+ V +F+ F   TV  RT  GQRQS++   Y  H Y+R+ GLC +   D  YPVR +++LLN+VLDEY      + WR  AQ  +      L   L KYQDP++AD ++++Q+ELDETKI+LHKTI+SVL RGEKLD+LV+KS  LSA+S+MFYKQAKKTN CC I+
Sbjct:    1 MKIYSIAILRNS--GNKALELCSAKDLSQFGFFERNGVSQFMTFFGETVAGRTGAGQRQSIEEGNYVGHVYSRSEGLCGVLITDKEYPVRPAYTLLNKVLDEYLVAHPPAEWRDIAQTSDQLKLRELEMYLAKYQDPSQADSIMRVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKKTNSCCLIM 200          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_SCHPO (Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe GN=ykt6 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 4.232e-47
Identity = 99/201 (49.25%), Postives = 139/201 (69.15%), Query Frame = -1
Query:  202 MKITALLVLKCNPDGSDPV-VLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRN-GLCAMGFMDDHYPVRSSFSLLNQVLDEY-QKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTI 795
            MK+ ++ +L+ +P    PV +L TA D+S F +FQRSS+ EF+ F  +TV +RT PGQRQ V+   Y  H YNR+ GLC +   D  YP+R +++LLN++LDE+  KN    W +        +P L+  L+KYQDP +AD ++++Q+ELDETK +LHKTI+SVLARGEKLD L+++S +LS  S+MFYK AKK N CC I
Sbjct:    1 MKLYSVSILRFDPK---PVQLLCTASDLSSFSFFQRSSIGEFMNFFTKTVAERTNPGQRQDVEQSNYVFHVYNRSDGLCGVIASDKEYPLRVAYTLLNKILDEFLTKNPRTKWESGAVT--LSFPELDTYLSKYQDPKQADTIMRVQQELDETKDVLHKTIESVLARGEKLDDLIQRSDNLSTQSRMFYKSAKKQNSCCII 196          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_CANGA (Synaptobrevin homolog YKT6 OS=Candida glabrata GN=YKT6 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.583e-46
Identity = 95/182 (52.20%), Postives = 130/182 (71.43%), Query Frame = -1
Query:  199 LATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRN-GLCAMGFMDDHYPVRSSFSLLNQVLDEYQ-KNFGESWRTAQADNMQ-PWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 735
            L    D+S FG+F+R+SV +F+ F A TV  RT  GQRQSV+   Y  H Y R+ G+C +   D  YPVR +++LLN+VLDEY   +  + W++  A N       L+  ++KYQDPA+AD ++K+Q+ELDETKI+LHKTI++VL RGEKLD+LV+KS  L+A+S+MFYKQAKKTN CC I+
Sbjct:   24 LTEVKDLSQFGFFERNSVGQFMTFFAETVATRTTAGQRQSVEEGNYIGHVYARSEGICGVLITDKDYPVRPAYTLLNKVLDEYLVAHPADQWKSITATNDSLKMAELSTYISKYQDPAQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKTNSCCIIM 205          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_YEAST (Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae GN=YKT6 PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.778e-45
Identity = 92/188 (48.94%), Postives = 132/188 (70.21%), Query Frame = -1
Query:  199 GSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRN-GLCAMGFMDDHYPVRSSFSLLNQVLDEYQ-KNFGESWR-TAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 753
            G   + L+   D+S FG+F+RSSV +F+ F A TV  RT  GQRQS++   Y  H Y R+ G+C +   D  YPVR +++LLN++LDEY   +  E W    + ++      L+  ++KYQDP++AD ++K+Q+ELDETKI+LHKTI++VL RGEKLD+LV+KS  L+A+S+MFYKQAKK+N CC I+
Sbjct:   13 GEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYIGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKSNSCCIIM 200          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_DEBHA (Synaptobrevin homolog YKT6 OS=Debaryomyces hansenii GN=YKT6 PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.778e-45
Identity = 95/202 (47.03%), Postives = 136/202 (67.33%), Query Frame = -1
Query:  199 MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRN-GLCAMGFMDDHYPVRSSFSLLNQVLDEYQKNFGES-WRTAQADNMQ-PWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 795
            MKI  + +L+    G   + L +A D+S F +F+R+ V +F+ F + TV +RT  GQRQS++   Y  H+Y R+ GL  +   D  YPVR +++L+N++L+EY     +  W    A N    +  L   + KYQDP++AD ++K+Q+ELDETKI+LHKTI+SVL RGEKLDSLV+KS  LS++S+MFYKQAKKTN CC I+
Sbjct:    1 MKIYYIGILRIG--GEKALELTSARDLSQFSFFERNGVSQFMTFFSETVSQRTQAGQRQSIEEGNYIGHTYTRSEGLACVIITDKEYPVRPAYTLINKILEEYLSLHPQKDWANISATNASFNYDNLEHYIKKYQDPSQADSIMKVQQELDETKIVLHKTIESVLQRGEKLDSLVDKSEALSSSSRMFYKQAKKTNSCCIIM 200          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_KLULA (Synaptobrevin homolog YKT6 OS=Kluyveromyces lactis GN=YKT6 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.961e-45
Identity = 98/202 (48.51%), Postives = 139/202 (68.81%), Query Frame = -1
Query:  199 MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNR-NGLCAMGFMDDHYPVRSSFSLLNQVLDEYQKNFGE-SWR-TAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 795
            MKI  + VL+ + D +  + L++  D+S FG+F+R+SV +F+ F + TV  RT  GQRQSV+   Y  H Y R  G+C +   D  YPVR +++LLN+VLDEY        W+   ++D+      L+  + KYQDP++AD ++++Q+ELDETKI LHKTI++VL RGEKLD+LV+KS  LSAAS+MFYKQAKKTN CC ++
Sbjct:    1 MKIYYIGVLRNSDDKT--LELSSVKDLSQFGFFERNSVAQFMSFFSETVAGRTSAGQRQSVEEGNYVGHVYARPEGICGVLITDKEYPVRPAYTLLNKVLDEYLVAHPPIQWKDVTESDDSLKLKELDIYIAKYQDPSQADAIMRVQQELDETKITLHKTIENVLQRGEKLDNLVDKSESLSAASRMFYKQAKKTNSCCIVM 200          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_YARLI (Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica GN=YKT6 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.174e-45
Identity = 96/202 (47.52%), Postives = 143/202 (70.79%), Query Frame = -1
Query:  199 MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRN-GLCAMGFMDDHYPVRSSFSLLNQVLDEY-QKNFGESWRTA-QADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 795
            MK+  + +L+  P+  + V LA+A D+S + +F+RS+V +   F+A TV  RT PGQRQSV+  +Y  H+Y R+ GL  +   D  YPVR +++LLN+VL+EY  K+    W  A +A +    P L + + +YQDP +AD ++++Q+ELDETKI+LHKTI+SVLARGE+LD+LV+KS  LS +S++F+KQAKKTN CC ++
Sbjct:    1 MKLYYIGILR--PNKPEAVQLASASDLSSYSWFERSTVGQAFTFLAETVIPRTEPGQRQSVEENDYVGHAYLRSDGLGGVIITDQEYPVRVAYTLLNKVLEEYLTKHPKAEWENAKEASSKLAMPELEDYVKRYQDPHQADAIMRVQQELDETKIVLHKTIESVLARGERLDTLVDKSEALSQSSKIFFKQAKKTNSCCILM 200          
BLAST of CN188809 vs. ExPASy Swiss-Prot
Match: YKT6_BOVIN (Synaptobrevin homolog YKT6 OS=Bos taurus GN=YKT6 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.938e-40
Identity = 93/201 (46.27%), Postives = 126/201 (62.69%), Query Frame = -1
Query:  199 MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRN-GLCAMGFMDDHYPVRSSFSLLNQVLDEYQKNFGE-SWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL 795
            MK+ +L VL      S  V+L  A DVS F +FQRSSV+EF+ F ++ + +R+  G R SV+ +EY  H Y RN  L  +   D  YP R +F+LL +VLDE+ K      W T   D ++ +  L+  L++YQ+P EAD + K+Q ELDETKIILH T++S+L RGEKLD LV KS  L   S+ FYK A+K N CC I+
Sbjct:    1 MKLYSLSVLYKGE--SKTVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSAKGSRASVKEQEYLCHVYVRNDSLAGVVIADSEYPSRVAFTLLEKVLDEFSKQVDRIDWPTGSPDTIR-YSGLDSQLSRYQNPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGIQSKAFYKTARKQNSCCAIM 198          
The following BLAST results are available for this feature:
BLAST of CN188809 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
YKT61_ARATH1.810e-9886.93VAMP-like protein YKT61 OS=Arabidopsis thaliana GN... [more]
YKT62_ARATH1.645e-8375.12VAMP-like protein YKT62 OS=Arabidopsis thaliana GN... [more]
YKT6_ASHGO1.455e-4750.00Synaptobrevin homolog YKT6 OS=Ashbya gossypii GN=Y... [more]
YKT6_SCHPO4.232e-4749.25Synaptobrevin homolog ykt6 OS=Schizosaccharomyces ... [more]
YKT6_CANGA3.583e-4652.20Synaptobrevin homolog YKT6 OS=Candida glabrata GN=... [more]
YKT6_YEAST1.778e-4548.94Synaptobrevin homolog YKT6 OS=Saccharomyces cerevi... [more]
YKT6_DEBHA1.778e-4547.03Synaptobrevin homolog YKT6 OS=Debaryomyces hanseni... [more]
YKT6_KLULA3.961e-4548.51Synaptobrevin homolog YKT6 OS=Kluyveromyces lactis... [more]
YKT6_YARLI5.174e-4547.52Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica ... [more]
YKT6_BOVIN2.938e-4046.27Synaptobrevin homolog YKT6 OS=Bos taurus GN=YKT6 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006M21_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006M21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188809 ID=CN188809|Name=CN188809|organism=Citrus sinensis|type=EST|length=813bp
CTTTTCCCAANCTGTTTTCATATCTTTTTGATCATCCATAACACAGAACC
AGCGGTATGAAAAAACCACAATTCTTCCAACCAAACAATTGATATATGAT
ATACACATATAATAATCACCATTTCTGTAATCCATCAGCTTCAACACTAA
AACAAATGAGTGCCATTACAGGAGAACTGCTTGCCTCGAATGCTCTTACA
GTATGGTACAACATTGATTAGTTTTCTTTGCCTGCTTGTAGAACATCTGC
GAAGCTGCACTGAGATCTGAACTCTTCTCAACTAAACTGTCCAGCTTTTC
ACCCCGTGCAAGTACACTATCGATAGTTTTATGAAGGATAATCTTTGTTT
CATCCAATTCCCTCTGAATTTTCAACAGCTTATCAGCCTCCGCTGGGTCC
TGATATTTGTTCAAAGCTTCATTTAGATAAGGCCACGGTTGCATGTTGTC
TGCCTGTGCAGTCCTCCATGATTCACCAAAATTTTTCTGATACTCATCTA
GCACCTGGTTGAGAAGAGAGAATGAGCTTCGCACTGGATAATGATCATCC
ATGAATCCCATTGCGCAAAGTCCATTCCTGTTATAAGAATGCACCTTGTA
CTCTTCGTGTTGGACGGACTGGCGCTGGCCGGGCGGAGTCCGTTTACCGA
CAGTGCGAGCGACGAAGAGGATGAACTCCTTAACGCTGGATCGTTGAAAG
TAACCGAAATGGCTAACGTCCATGGCGGTCGCTAACACAACCGGATCCGA
TCCGTCCGGGTTGCACTTCAAAACCAGTAACGCCGTGATCTTCATCCTCC
TCCTGCTGTGAAA
back to top