CN188804

Overview
NameCN188804
Unique NameCN188804
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length376
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2579 contig Csv1_Contig2579:424..798. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.773e-23
Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 269
            MSDTCGNCDCAD++ CVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.640e-18
Identity = 38/64 (59.38%), Postives = 47/64 (73.44%), Query Frame = 3
Query:   81 TCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGS 272
            TCGNCDC D+S CVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.142e-18
Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 266
            MSD CGNCDCAD S CVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.834e-16
Identity = 37/65 (56.92%), Postives = 44/65 (67.69%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 266
            MS  C NCDC+D S C KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.834e-16
Identity = 38/66 (57.58%), Postives = 45/66 (68.18%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 269
            MS  C NCDCAD + CVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.217e-15
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 269
            MSD CGNCDCAD+S CVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.217e-15
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 269
            MSD CGNCDCAD+S CVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.540e-13
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 269
            MSD CGNCDCAD+S CVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of CN188804 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.345e-12
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 3
Query:   72 MSDTCGNCDCADRSPCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 269
            MSD CG+CDCAD+S CVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of CN188804 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA3.773e-2368.18Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC1.640e-1859.38Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE2.142e-1866.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV5.834e-1656.92Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO5.834e-1657.58Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ2.217e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI2.217e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ3.540e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI1.345e-1246.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006M18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006M18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188804 ID=CN188804|Name=CN188804|organism=Citrus sinensis|type=EST|length=376bp
GCATTAAGAAGTCGTANAATAAAGAGNCCTCTATTTCCAGTTCCATAAAA
GAAGTTCTAAGCTCAATCAACATGTCGGACACCTGCGGCAACTGCGACTG
CGCTGACAGGAGCCCCTGTGTGAAGAAGGGAAGCAGCTATGCTGCTGACT
TCGTCGAGACTGACTTGAGCTTTGTCAGCACCGTTGTTGTCATGGACGTT
CAGGCTGCTGAGGCTGAAGGTAACTGCAAGTGCGGCCCCACCTGCGCTTG
TGTGAACTGCACTTGTGGTAGTCACTAATAAGCAAACACATGCAGCAAAA
AATAAGAAGCTGCAAGTGTGCCTAAATATTGTGGGGGTTAAGAATAATGT
AAGGGTGATTAAAAAAAAAAAAAAAA
back to top