CN188801

Overview
NameCN188801
Unique NameCN188801
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length773
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6145 contig Csv1_Contig6145:41..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM_HEVBR (Superoxide dismutase [Mn], mitochondrial OS=Hevea brasiliensis GN=SODA PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 1.103e-102
Identity = 178/224 (79.46%), Postives = 192/224 (85.71%), Query Frame = 3
Query:   42 PFGIRKAIGLGKSVRLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 713
            P   + A GLG+     LRGLQT +LPDLPYDY ALEPAISGEIMQLHHQ+ HQ Y+TNYNKA+EQL  A+ K D++ VV+LQ AIKFNGGGHVNHSIFWKNLAPV EGGGE PH SLGWAIDA FGSLE LIQ M+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VMNWKYAS+VY KECP
Sbjct:   13 PSAFKAATGLGQ-----LRGLQTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVKLQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYASEVYAKECP 231          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM_NICPL (Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia GN=SODA PE=1 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 3.209e-102
Identity = 173/228 (75.88%), Postives = 192/228 (84.21%), Query Frame = 3
Query:   30 MALPPFGIRKAIGLGKSVRLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 713
            MAL     R+ +  G   R  LRGLQT +LPDLPYDY ALEPAISG+IMQLHHQ  HQ YVTNYNKA+EQL  A++K D  TV +L  AIKFNGGGH+NHSIFWKNLAPV EGGGEPP  SLGWAID +FGSLEAL+QKM+AEGAALQGSGWVWLG+D E KRLV+ETTANQDPLV+K   LVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VMNWKYA++VY+KECP
Sbjct:    1 MALRTLVSRRTLATGLGFRQQLRGLQTFSLPDLPYDYGALEPAISGDIMQLHHQNHHQTYVTNYNKALEQLHDAISKGDAPTVAKLHSAIKFNGGGHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLGVDKELKRLVIETTANQDPLVSKGANLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYANEVYEKECP 228          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM_PRUPE (Superoxide dismutase [Mn], mitochondrial OS=Prunus persica GN=SOD PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 9.336e-102
Identity = 174/228 (76.32%), Postives = 192/228 (84.21%), Query Frame = 3
Query:   30 MALPPFGIRKAIGLGKSVRLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 713
            MAL     R+ +  G   R  LRGLQT +LPDLPY+Y ALEPAISG+IMQLHHQ  HQ YVTNYNKA+EQL  A++K D  TV +L  AIKFNGGGH+NHSIFWKNLAPV EGGGEPP  SLGWAID +FGSLEAL+QKM+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+NWKYAS+VY+KE P
Sbjct:    1 MALRTLVSRRTLATGLGFRQQLRGLQTFSLPDLPYNYGALEPAISGDIMQLHHQNHHQTYVTNYNKALEQLHDAISKGDAPTVAKLHSAIKFNGGGHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESP 228          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM_ARATH (Superoxide dismutase [Mn], mitochondrial OS=Arabidopsis thaliana GN=SODA PE=1 SV=2)

HSP 1 Score: 358.992 bits (920), Expect = 1.648e-98
Identity = 167/207 (80.68%), Postives = 187/207 (90.34%), Query Frame = 3
Query:   87 LGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKE 707
            L +RG+QT TLPDLPYDY ALEPAISGEIMQ+HHQ+ HQAYVTNYN A+EQL QA+NK D STVV+LQ AIKFNGGGHVNHSIFWKNLAP  EGGGEPP  SLG AIDAHFGSLE L++KMSAEGAA+QGSGWVWLGLD E K+LVV+TTANQDPLVTK  +LVPL+GIDVWEHAYYLQYKNV+P+YLKN+W V+NWKYAS+VY+KE
Sbjct:   23 LRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKE 229          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM_CAPAN (Superoxide dismutase [Mn], mitochondrial OS=Capsicum annuum GN=SODA PE=2 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 3.671e-98
Identity = 169/228 (74.12%), Postives = 190/228 (83.33%), Query Frame = 3
Query:   30 MALPPFGIRKAIGLGKSVRLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 713
            MAL     +K      + R  LR +QT +LPDL YDY ALEPAISGEIMQLHHQ+ HQ Y+TNYN A++QL  A+NK D+ TV +LQGAIKFNGGGH+NHS+FWKNLAP  EGGGEPP  SLG AID +FGSLEA+IQKM+AEGAALQGSGWVWLGLD E KRLV+ETTANQDPLV K P LVPLLGIDVWEHAYYLQYKNVKPDYLKNIW V+NWKYA++VY+KECP
Sbjct:    1 MALRNLMTKKPFAGILTFRQQLRCVQTFSLPDLSYDYGALEPAISGEIMQLHHQKHHQTYITNYNNALQQLHDAINKGDSPTVAKLQGAIKFNGGGHINHSVFWKNLAPTREGGGEPPKGSLGSAIDTNFGSLEAVIQKMNAEGAALQGSGWVWLGLDKELKRLVIETTANQDPLVIKGPNLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWKVINWKYAAEVYEKECP 228          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM1_MAIZE (Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays GN=SODA.4 PE=2 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 3.932e-92
Identity = 160/220 (72.73%), Postives = 178/220 (80.91%), Query Frame = 3
Query:   42 PFGIRKAIGLGKSVRLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 701
            PFG     G   +     RG+ TVTLPDL YD+ ALEPAISGEIM+LHHQ+ H  YV NYNKA+EQL  A++K D S VVQLQ AIKFNGGGHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL++KM+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   15 PFG---GAGRPLAAAASARGVTTVTLPDLSYDFGALEPAISGEIMRLHHQKHHATYVANYNKALEQLETAVSKGDASAVVQLQAAIKFNGGGHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKKMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 231          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM_ORYSJ (Superoxide dismutase [Mn], mitochondrial OS=Oryza sativa subsp. japonica GN=SODA PE=2 SV=2)

HSP 1 Score: 335.495 bits (859), Expect = 1.951e-91
Identity = 161/227 (70.93%), Postives = 177/227 (77.97%), Query Frame = 3
Query:   30 MALPPFGIRK---AIGLGKSVRLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 701
            MAL     RK   A  L  +     RG+ TV LPDLPYDY ALEPAISGEIM+LHHQ+ H  YV NYNKA+EQL  A+ K D   +V LQ AIKFNGGGHVNHSIFW NL P+ EGGG+PPH+ LGWAID  FGS EAL++KMSAEGAALQGSGWVWL LD E K+L VETTANQDPLVTK   LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:    1 MALRTLASRKTLAAAALPLAAAAAARGVTTVALPDLPYDYGALEPAISGEIMRLHHQKHHATYVANYNKALEQLDAAVAKGDAPAIVHLQSAIKFNGGGHVNHSIFWNNLKPISEGGGDPPHAKLGWAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALDKEAKKLSVETTANQDPLVTKGANLVPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYE 227          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM4_MAIZE (Superoxide dismutase [Mn] 3.4, mitochondrial OS=Zea mays GN=SODA.3 PE=2 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 2.548e-91
Identity = 157/212 (74.06%), Postives = 174/212 (82.08%), Query Frame = 3
Query:   66 GLGKSVRLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 701
            G  +      RG+ TV LPDL YD+ ALEPAISGEIM+LHHQ+ H  YV NYNKA+EQL  A+ K D S VVQLQGAIKFNGGGHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL+++M+AEGAALQGSGWVWL LD E K+L VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   18 GAARPSAASARGVTTVALPDLSYDFGALEPAISGEIMRLHHQKHHATYVGNYNKALEQLDAAVAKGDASAVVQLQGAIKFNGGGHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEPKKLSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM3_MAIZE (Superoxide dismutase [Mn] 3.3, mitochondrial OS=Zea mays GN=SODA.2 PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 4.806e-90
Identity = 152/202 (75.25%), Postives = 170/202 (84.16%), Query Frame = 3
Query:   96 RGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 701
            RG+ TV LPDL YD+ ALEP ISGEIM+LHHQ+ H  YV NYNKA+EQ+   + K D S VVQLQGAIKFNGGGHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL+++M+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   28 RGVTTVALPDLSYDFGALEPVISGEIMRLHHQKNHATYVVNYNKALEQIDDVVVKGDDSAVVQLQGAIKFNGGGHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          
BLAST of CN188801 vs. ExPASy Swiss-Prot
Match: SODM_PEA (Superoxide dismutase [Mn], mitochondrial OS=Pisum sativum GN=SODA PE=2 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 4.069e-89
Identity = 157/204 (76.96%), Postives = 174/204 (85.29%), Query Frame = 3
Query:   96 RGLQTVTLPDLPYDYSALEPAISGEIMQLHHQRRHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNGGGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDAHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKE 707
            RGL   TLPDL YDY ALEP ISGEIMQ+HHQ+ HQ Y+TNYNKA+EQL  A+ K DTST V+LQ AIKFNGGGH+NHSIFWKNLAPV EGGGEPP  SLGWAID +FGSLEALIQK++AEGAALQ     WLGLD + KRLVVETT  QDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+NWK+AS+VY+KE
Sbjct:   35 RGLHVFTLPDLAYDYGALEPVISGEIMQIHHQKHHQTYITNYNKALEQLHDAVAKADTSTTVKLQNAIKFNGGGHINHSIFWKNLAPVSEGGGEPPKESLGWAIDTNFGSLEALIQKINAEGAALQ-----WLGLDKDLKRLVVETT--QDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKHASEVYEKE 231          
The following BLAST results are available for this feature:
BLAST of CN188801 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 225
Match NameE-valueIdentityDescription
SODM_HEVBR1.103e-10279.46Superoxide dismutase [Mn], mitochondrial OS=Hevea ... [more]
SODM_NICPL3.209e-10275.88Superoxide dismutase [Mn], mitochondrial OS=Nicoti... [more]
SODM_PRUPE9.336e-10276.32Superoxide dismutase [Mn], mitochondrial OS=Prunus... [more]
SODM_ARATH1.648e-9880.68Superoxide dismutase [Mn], mitochondrial OS=Arabid... [more]
SODM_CAPAN3.671e-9874.12Superoxide dismutase [Mn], mitochondrial OS=Capsic... [more]
SODM1_MAIZE3.932e-9272.73Superoxide dismutase [Mn] 3.1, mitochondrial OS=Ze... [more]
SODM_ORYSJ1.951e-9170.93Superoxide dismutase [Mn], mitochondrial OS=Oryza ... [more]
SODM4_MAIZE2.548e-9174.06Superoxide dismutase [Mn] 3.4, mitochondrial OS=Ze... [more]
SODM3_MAIZE4.806e-9075.25Superoxide dismutase [Mn] 3.3, mitochondrial OS=Ze... [more]
SODM_PEA4.069e-8976.96Superoxide dismutase [Mn], mitochondrial OS=Pisum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006M17_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006M17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188801 ID=CN188801|Name=CN188801|organism=Citrus sinensis|type=EST|length=773bp
ACGATCAGAACGTCACCGTTTCATTCGCGATGGCTCTCCCCCCTTTTGGC
ATCAGAAAAGCTATAGGCTTGGGTAAATCCGTCCGATTAGGGCTGCGTGG
ACTGCAGACGGTCACGCTGCCTGATCTTCCGTACGATTACAGCGCTTTGG
AGCCGGCGATTAGCGGAGAGATTATGCAGCTTCATCACCAGAGGCGTCAC
CAGGCTTACGTTACTAACTACAACAAGGCGGTCGAGCAGCTTTTTCAAGC
TTTGAACAAAGTCGATACGTCCACCGTCGTCCAGTTGCAGGGCGCTATCA
AGTTCAACGGCGGAGGTCATGTCAACCACTCAATTTTCTGGAAGAATCTT
GCTCCTGTTCACGAAGGAGGTGGCGAGCCACCACATAGTTCCCTTGGTTG
GGCTATTGACGCGCATTTTGGTTCTCTGGAAGCATTGATACAAAAGATGA
GTGCTGAGGGTGCAGCTTTGCAGGGCTCTGGATGGGTGTGGCTTGGTTTG
GATACAGAGTTTAAAAGGCTTGTGGTTGAAACTACTGCAAATCAGGATCC
GCTGGTGACTAAAGCCCCAACTCTGGTTCCTTTGCTTGGTATAGATGTTT
GGGAGCATGCATACTACCTACAGTACAAGAATGTCAAACCAGATTATCTG
AAAAACATTTGGAACGTAATGAACTGGAAGTATGCTAGTGATGTGTATCA
GAAAGAATGCCCTTAAGCTTGGAGCTCTTCCTTGAGCATGGAGTTCTTCG
TTTGATCTGGGTTCTCTCTTGGG
back to top