CN188800

Overview
NameCN188800
Unique NameCN188800
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length710
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2687 contig Csv1_Contig2687:1..710. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: Y1390_ARATH (Uncharacterized protein At1g03900 OS=Arabidopsis thaliana GN=At1g03900 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.327e-30
Identity = 69/145 (47.59%), Postives = 92/145 (63.45%), Query Frame = 2
Query:  257 ENEETEAIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGEL-HPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEME 688
            E EE E  E  L  V E  VY IPPR ++  Y+  EW  +   W G L+VVS  + C I+LED ++G+L+A  F+  G   + VEP +DSSRYFVLRI++   GR ++AFIG+GF ER EA+DF  AL DH KY+ ++K  E  E
Sbjct:    5 EEEEEETFEHTLLVVREVSVYKIPPRTTSGGYKCGEWLQSDKIWSGRLRVVSCKDRCEIRLEDSNSGDLFAACFVDPGRRENSVEPSLDSSRYFVLRIDD---GRGKYAFIGLGFAERNEAFDFNVALSDHEKYVRREKEKETGE 146          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP2_RAT (Adaptin ear-binding coat-associated protein 2 OS=Rattus norvegicus GN=Necap2 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.470e-26
Identity = 64/135 (47.41%), Postives = 91/135 (67.41%), Query Frame = 2
Query:  263 EETEAIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKK 667
            EE+E  E VL    E +VY IPPR +   YRA EW +++ +W G L++ +KG+   IKLED+++GEL+A+A + +     VE V DSSRYFV+RIE+  G   R AFIGIGF +R +A+DF  AL DH K++ ++
Sbjct:    2 EESE-YESVLCVKPEVHVYRIPPRATNRGYRASEWQLDQPSWSGRLRITAKGKVAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNG---RRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQ 132          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP2_MOUSE (Adaptin ear-binding coat-associated protein 2 OS=Mus musculus GN=Necap2 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.507e-26
Identity = 63/135 (46.67%), Postives = 91/135 (67.41%), Query Frame = 2
Query:  263 EETEAIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKK 667
            EE+E  E VL    E +VY IPPR +   YRA EW +++ +W G L++ +KG+   IKLED+++GEL+A+A + +     VE V DSSRYFV+RIE+  G   R AFIG+GF +R +A+DF  AL DH K++ ++
Sbjct:    2 EESE-YESVLCVKPEVHVYRIPPRATNRGYRASEWQLDQPSWSGRLRITAKGKVAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNG---RRAFIGLGFGDRGDAFDFNVALQDHFKWVKQQ 132          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP2_HUMAN (Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens GN=NECAP2 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.277e-26
Identity = 61/134 (45.52%), Postives = 88/134 (65.67%), Query Frame = 2
Query:  266 ETEAIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKK 667
            E    E VL    + +VY IPPR +   YRA EW +++ +W G L++ +KG+   IKLED+++GEL+A+A + +     VE V DSSRYFV+RIE+  G   R AFIGIGF +R +A+DF  AL DH K++ ++
Sbjct:    2 EESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNG---RRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQ 132          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP2_BOVIN (Adaptin ear-binding coat-associated protein 2 OS=Bos taurus GN=NECAP2 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.586e-26
Identity = 63/135 (46.67%), Postives = 90/135 (66.67%), Query Frame = 2
Query:  263 EETEAIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKK 667
            EE E  E VL    + +VY IPPR +   YRA EW +++ +W G L++ +KG+   IKLED+++GEL+A+A + +     VE V DSSRYFV+RIE+  G   R AFIGIGF +R +A+DF  AL DH K++ ++
Sbjct:    2 EEAE-YESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQVAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNG---RRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQ 132          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP1_BOVIN (Adaptin ear-binding coat-associated protein 1 OS=Bos taurus GN=NECAP1 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.295e-26
Identity = 62/141 (43.97%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  281 EFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQS 703
            E VL    +  VY IPPR S   YRA +W +++  W G L++ SKG+   IKLEDK +GEL+A+A + +     VE V DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  S
Sbjct:    8 ESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKVAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTG---RSAFIGIGFSDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDS 145          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP1_RAT (Adaptin ear-binding coat-associated protein 1 OS=Rattus norvegicus GN=Necap1 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.244e-25
Identity = 62/141 (43.97%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  281 EFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQS 703
            E VL    +  VY IPPR S   YRA +W +++  W G L++ SKG+   IKLEDK +GEL+A+A + +     VE V DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  S
Sbjct:    8 ESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVADSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKESQEMDS 145          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP1_PONAB (Adaptin ear-binding coat-associated protein 1 OS=Pongo abelii GN=NECAP1 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.244e-25
Identity = 61/141 (43.26%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  281 EFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQS 703
            E VL    +  VY IPPR S   YRA +W +++  W G L++ SKG+   IKLEDK +GEL+A+A + +     VE V DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  +
Sbjct:    8 ESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDA 145          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP1_HUMAN (Adaptin ear-binding coat-associated protein 1 OS=Homo sapiens GN=NECAP1 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.244e-25
Identity = 61/141 (43.26%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  281 EFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQS 703
            E VL    +  VY IPPR S   YRA +W +++  W G L++ SKG+   IKLEDK +GEL+A+A + +     VE V DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  +
Sbjct:    8 ESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDA 145          
BLAST of CN188800 vs. ExPASy Swiss-Prot
Match: NECP1_MOUSE (Adaptin ear-binding coat-associated protein 1 OS=Mus musculus GN=Necap1 PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 2.123e-25
Identity = 63/142 (44.37%), Postives = 91/142 (64.08%), Query Frame = 2
Query:  281 EFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKK----KTAEEMEQQ 694
            E VL    +  VY IPPR S   YRA +W +++  W G L++ SKG+   IKLEDK +GEL+A+A + +     VE V DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    K ++EM+ +
Sbjct:    8 ESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKESQEMDNR 146          
The following BLAST results are available for this feature:
BLAST of CN188800 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
Y1390_ARATH8.327e-3047.59Uncharacterized protein At1g03900 OS=Arabidopsis t... [more]
NECP2_RAT1.470e-2647.41Adaptin ear-binding coat-associated protein 2 OS=R... [more]
NECP2_MOUSE2.507e-2646.67Adaptin ear-binding coat-associated protein 2 OS=M... [more]
NECP2_HUMAN4.277e-2645.52Adaptin ear-binding coat-associated protein 2 OS=H... [more]
NECP2_BOVIN5.586e-2646.67Adaptin ear-binding coat-associated protein 2 OS=B... [more]
NECP1_BOVIN7.295e-2643.97Adaptin ear-binding coat-associated protein 1 OS=B... [more]
NECP1_RAT1.244e-2543.97Adaptin ear-binding coat-associated protein 1 OS=R... [more]
NECP1_PONAB1.244e-2543.26Adaptin ear-binding coat-associated protein 1 OS=P... [more]
NECP1_HUMAN1.244e-2543.26Adaptin ear-binding coat-associated protein 1 OS=H... [more]
NECP1_MOUSE2.123e-2544.37Adaptin ear-binding coat-associated protein 1 OS=M... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006M16_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006M16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188800 ID=CN188800|Name=CN188800|organism=Citrus sinensis|type=EST|length=710bp
GCAGGGGACATTCCAATTGTATTCCAATCTCATACCCACCTCTTCTCTTA
ATAGACCATTGTAATTATACTAAATTATCGTCCTGTCCTTACCCGACTGA
ACTGAAAAGTAAAAACTGAAATCCTCTTAATCTGTCTAAAAATTGGAAAA
AGAAAAAAGAAAAAAGAGTGTATTGATTTTCTCTCTTTAGATCATGATGG
CGAAGGAAGAAGAGAAGAAAGTAAGAGAAATAGAGGATCAAAACGACGTC
GTGGGCGAGAACGAAGAAACTGAAGCTATAGAGTTTGTTCTCTTTCAAGT
CTCGGAATGTTACGTTTATTTGATACCCCCGAGGAAAAGTGCAGCTTCAT
ACAGGGCTGATGAATGGAATGTTAACAAATGGGCATGGGAGGGAATGCTA
AAAGTTGTCAGCAAGGGAGAAGAGTGCATTATCAAACTTGAAGATAAGTC
CACAGGTGAATTATATGCTCGGGCATTTTTGAGAAAGGGTGAACTGCATC
CAGTGGAACCTGTGATTGATAGCAGCAGGTACTTTGTTCTTCGGATAGAG
GAAAACATAGGTGGTCGCCTTAGGCATGCTTTCATTGGCATCGGATTCCG
GGAAAGGACAGAAGCTTATGATTTCCAAGCAGCCCTTCATGATCACATGA
AATATTTGGACAAAAAGAAAACTGCAGAAGAGATGGAACAGCAATTCCAG
AGCACATCAG
back to top