CN188799

Overview
NameCN188799
Unique NameCN188799
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length837
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2687 contig Csv1_Contig2687:515..1334. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: Y1390_ARATH (Uncharacterized protein At1g03900 OS=Arabidopsis thaliana GN=At1g03900 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.660e-15
Identity = 43/89 (48.31%), Postives = 60/89 (67.42%), Query Frame = -1
Query:  586 IDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAE-----EMEQQFQSTSAVDYSLKEGETLHLHLKNK 837
            +DSSRYFVLRI++   GR ++AFIG+GF ER EA+DF  AL DH KY+ ++K  E     E +       AV++ LKEGET+ +++K K
Sbjct:   92 LDSSRYFVLRIDD---GRGKYAFIGLGFAERNEAFDFNVALSDHEKYVRREKEKETGETSESDNHIDIHPAVNHRLKEGETIRINVKPK 177          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP1_BOVIN (Adaptin ear-binding coat-associated protein 1 OS=Bos taurus GN=NECAP1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.490e-13
Identity = 43/105 (40.95%), Postives = 60/105 (57.14%), Query Frame = -1
Query:  529 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKN---KSSGRVKSKFFEQGLNDLSL 834
            DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  S   +D   KEG+T+ L + N   K  G  K K    G   LSL
Sbjct:   87 DSSRYFVIRIQDGTG---RSAFIGIGFSDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDSRPKLDLGFKEGQTIKLSIGNITTKKGGTSKPK--TAGTGGLSL 186          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP1_RAT (Adaptin ear-binding coat-associated protein 1 OS=Rattus norvegicus GN=Necap1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.223e-12
Identity = 42/105 (40.00%), Postives = 60/105 (57.14%), Query Frame = -1
Query:  529 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKN---KSSGRVKSKFFEQGLNDLSL 834
            DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  S   +D   KEG+T+ L + N   K  G  K +    G   LSL
Sbjct:   87 DSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKESQEMDSRPKLDLGFKEGQTIKLSIGNITAKKGGTSKPR--ASGTGGLSL 186          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP1_PONAB (Adaptin ear-binding coat-associated protein 1 OS=Pongo abelii GN=NECAP1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.597e-12
Identity = 37/94 (39.36%), Postives = 57/94 (60.64%), Query Frame = -1
Query:  562 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHL---HLKNKSSGRVKSK 834
            DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  +   +D   KEG+T+ L   ++ NK  G  K +
Sbjct:   87 DSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDARPKLDLGFKEGQTIKLSIGNITNKEGGASKPR 177          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP1_HUMAN (Adaptin ear-binding coat-associated protein 1 OS=Homo sapiens GN=NECAP1 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.597e-12
Identity = 37/94 (39.36%), Postives = 57/94 (60.64%), Query Frame = -1
Query:  562 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHL---HLKNKSSGRVKSK 834
            DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  +   +D   KEG+T+ L   ++ NK  G  K +
Sbjct:   87 DSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPR 177          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP1_MOUSE (Adaptin ear-binding coat-associated protein 1 OS=Mus musculus GN=Necap1 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.725e-12
Identity = 41/105 (39.05%), Postives = 60/105 (57.14%), Query Frame = -1
Query:  529 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKN---KSSGRVKSKFFEQGLNDLSL 834
            DSSRYFV+RI++  G   R AFIGIGF +R +A+DF  +L DH K++ ++    +  Q+  +   +D   KEG+T+ L + N   K  G  K +    G   LSL
Sbjct:   87 DSSRYFVIRIQDGTG---RSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKESQEMDNRPKLDLGFKEGQTIKLSIGNITAKKGGASKPR--ASGTGGLSL 186          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP2_HUMAN (Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens GN=NECAP2 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.352e-11
Identity = 36/82 (43.90%), Postives = 51/82 (62.20%), Query Frame = -1
Query:  589 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKN 834
            DSSRYFV+RIE+  G   R AFIGIGF +R +A+DF  AL DH K++ ++    +  Q       +D   KEG+T+ L++ N
Sbjct:   86 DSSRYFVIRIEDGNG---RRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIAN 164          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP2_BOVIN (Adaptin ear-binding coat-associated protein 2 OS=Bos taurus GN=NECAP2 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.766e-11
Identity = 36/80 (45.00%), Postives = 51/80 (63.75%), Query Frame = -1
Query:  595 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHL 834
            DSSRYFV+RIE+  G   R AFIGIGF +R +A+DF  AL DH K++ ++    +  Q       +D S KEG+T+ L++
Sbjct:   86 DSSRYFVIRIEDGNG---RRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLSFKEGQTIKLNI 162          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP2_RAT (Adaptin ear-binding coat-associated protein 2 OS=Rattus norvegicus GN=Necap2 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 2.306e-11
Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = -1
Query:  589 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKN 834
            DSSRYFV+RIE+  G   R AFIGIGF +R +A+DF  AL DH K++ ++    +  Q       +D   KEG+T+ +++ N
Sbjct:   86 DSSRYFVIRIEDGNG---RRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDEGPKLDLGFKEGQTIKINIAN 164          
BLAST of CN188799 vs. ExPASy Swiss-Prot
Match: NECP2_MOUSE (Adaptin ear-binding coat-associated protein 2 OS=Mus musculus GN=Necap2 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.764e-11
Identity = 33/82 (40.24%), Postives = 51/82 (62.20%), Query Frame = -1
Query:  589 DSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKN 834
            DSSRYFV+RIE+  G   R AFIG+GF +R +A+DF  AL DH K++ ++    +  Q       +D   K+G+T+ +++ N
Sbjct:   86 DSSRYFVIRIEDGNG---RRAFIGLGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDEGPKLDLGFKDGQTIKINIAN 164          
The following BLAST results are available for this feature:
BLAST of CN188799 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
Y1390_ARATH7.660e-1548.31Uncharacterized protein At1g03900 OS=Arabidopsis t... [more]
NECP1_BOVIN5.490e-1340.95Adaptin ear-binding coat-associated protein 1 OS=B... [more]
NECP1_RAT1.223e-1240.00Adaptin ear-binding coat-associated protein 1 OS=R... [more]
NECP1_PONAB1.597e-1239.36Adaptin ear-binding coat-associated protein 1 OS=P... [more]
NECP1_HUMAN1.597e-1239.36Adaptin ear-binding coat-associated protein 1 OS=H... [more]
NECP1_MOUSE2.725e-1239.05Adaptin ear-binding coat-associated protein 1 OS=M... [more]
NECP2_HUMAN1.352e-1143.90Adaptin ear-binding coat-associated protein 2 OS=H... [more]
NECP2_BOVIN1.766e-1145.00Adaptin ear-binding coat-associated protein 2 OS=B... [more]
NECP2_RAT2.306e-1142.68Adaptin ear-binding coat-associated protein 2 OS=R... [more]
NECP2_MOUSE8.764e-1140.24Adaptin ear-binding coat-associated protein 2 OS=M... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006M16_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006M16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188799 ID=CN188799|Name=CN188799|organism=Citrus sinensis|type=EST|length=837bp
TTTTTTTTTTTTTTTTTACAAGGTAACATTCTCAGAAAATTCTGATAACT
ATTATCCACAAAGACTAATTACAGATAGTCCAGAATCAACAAGACTGGTG
TTCAAAAAATTTCACATGTTTAAAAAAAAAATATTAAAACAACAACAAGG
TAACTTGGTTATGTAGTATTTACCAAATATTTACCACATCACAGAAATAT
TTTTAGCTGTGCCAATCATAAAACAAGAGACTCCCCACTATTCCAGTATG
ATCTGTCAATCTCATAGAACATTTCATCCTGCAGCTTGAAAATCCCCAAA
ATCATCATCTGGTATATCCTCAGTATTTGGGCTTTTGGGGGAATGTTGTT
CTTTTGAGTCTTCTTTGGTTGAGTCTGGAGACGCATCCTTAGAACTTCCT
TCAAGACTGAATTTTTGTGGTGAGTTTGAGGGAGACATCCGAGCAGCTGT
AGCAGGTGAAAGAGGTGCTGGGGGAGGTGGCAGTGGTTTGAGACAAATCA
CGGGTTCTTTACGGTTACCCTTATCGTCCAATGAGAGATCATTCAGACCC
TGCTCAAAAAACTTGGATTTCACTCGGCCACTGCTTTTGTTCTTTAGATG
GAGGTGAAGGGTCTCCCCCTCTTTTAAACTGTAATCAACAGCTGATGTGC
TCTGGAATTGCTGTTCCATCTCTTCTGCAGTTTTCTTTTTGTCCAAATAT
TTCATGTGATCATGAAGGGCTGCTTGGAAATCATAAGCTTCTGTCCTTTC
CCGGAATCCGATGCCAATGAAAGCATGCCTAAGGCGACCACCTATGTTTT
CCTCTATCCGAAGAACAAAGTACCTGCTGCTATCAAT
back to top