CN181708
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN181708 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.109e-11 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 534 TKVFHPNINSNGSICLDILKEQWSPALTVSKMV 632 TKVFHPNINSNGSICLDILKEQWSPALT+SK++ Sbjct: 71 TKVFHPNINSNGSICLDILKEQWSPALTISKVL 103
BLAST of CN181708 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.109e-11 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 534 TKVFHPNINSNGSICLDILKEQWSPALTVSKMV 632 TKVFHPNINSNGSICLDILKEQWSPALT+SK++ Sbjct: 71 TKVFHPNINSNGSICLDILKEQWSPALTISKVL 103
BLAST of CN181708 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.109e-11 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 534 TKVFHPNINSNGSICLDILKEQWSPALTVSKMV 632 TKVFHPNINSNGSICLDILKEQWSPALT+SK++ Sbjct: 71 TKVFHPNINSNGSICLDILKEQWSPALTISKVL 103
BLAST of CN181708 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.109e-11 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 534 TKVFHPNINSNGSICLDILKEQWSPALTVSKMV 632 TKVFHPNINSNGSICLDILKEQWSPALT+SK++ Sbjct: 71 TKVFHPNINSNGSICLDILKEQWSPALTISKVL 103
BLAST of CN181708 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.061e-11 Identity = 29/33 (87.88%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 534 TKVFHPNINSNGSICLDILKEQWSPALTVSKMV 632 TKVFHPN+NSNGSICLDILKEQWSPALT+SK++ Sbjct: 71 TKVFHPNVNSNGSICLDILKEQWSPALTISKVL 103
BLAST of CN181708 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 5.304e-11 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 534 TKVFHPNINSNGSICLDILKEQWSPALTVSKMV 632 TKV+HPNINSNGSICLDILKEQWSPALTVSK++ Sbjct: 71 TKVYHPNINSNGSICLDILKEQWSPALTVSKVL 103
BLAST of CN181708 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 6.927e-11 Identity = 29/33 (87.88%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 534 TKVFHPNINSNGSICLDILKEQWSPALTVSKMV 632 TKV+HPNINSNGSICLDILKEQWSPALT+SK++ Sbjct: 71 TKVYHPNINSNGSICLDILKEQWSPALTISKVL 103 The following BLAST results are available for this feature:
BLAST of CN181708 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 7
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN181708 ID=CN181708; Name=CN181708; organism=Citrus sinensis; type=EST; length=632bpback to top |