CN188640

Overview
NameCN188640
Unique NameCN188640
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length702
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A3_ORYSJ (Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 2.326e-85
Identity = 144/149 (96.64%), Postives = 148/149 (99.33%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIE+Q+FCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA QFNHTNGLSLISRAHQLVMEG+NWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENM+QNFLQFDPAPRQIEPDTTRKTPD
Sbjct:  156 LIENQVFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAQQFNHTNGLSLISRAHQLVMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQIEPDTTRKTPD 304          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A3_ORYSI (Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2)

HSP 1 Score: 315.079 bits (806), Expect = 2.326e-85
Identity = 144/149 (96.64%), Postives = 148/149 (99.33%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIE+Q+FCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA QFNHTNGLSLISRAHQLVMEG+NWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENM+QNFLQFDPAPRQIEPDTTRKTPD
Sbjct:  156 LIENQVFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAQQFNHTNGLSLISRAHQLVMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQIEPDTTRKTPD 304          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A2_ARATH (Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 3.967e-85
Identity = 143/149 (95.97%), Postives = 148/149 (99.33%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIESQ+FCLHGGLSPSLDTLDNIR+LDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA+QFNH NGLSLISRAHQLVMEG+NWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQ+EPDTTRKTPD
Sbjct:  155 LIESQVFCLHGGLSPSLDTLDNIRSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHNNGLSLISRAHQLVMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQVEPDTTRKTPD 303          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A1_ORYSJ (Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 6.767e-85
Identity = 142/149 (95.30%), Postives = 148/149 (99.33%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            L+E+Q+FCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA QFNHTNGL+LISRAHQLVMEG+NWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENM+QNFLQFDPAPRQIEPDTTRKTPD
Sbjct:  155 LVENQVFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAQQFNHTNGLTLISRAHQLVMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQIEPDTTRKTPD 303          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A1_ORYSI (Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 6.767e-85
Identity = 142/149 (95.30%), Postives = 148/149 (99.33%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            L+E+Q+FCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA QFNHTNGL+LISRAHQLVMEG+NWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENM+QNFLQFDPAPRQIEPDTTRKTPD
Sbjct:  155 LVENQVFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAQQFNHTNGLTLISRAHQLVMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQIEPDTTRKTPD 303          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A5_ARATH (Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 1.969e-84
Identity = 141/149 (94.63%), Postives = 149/149 (100.00%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIESQ+FCLHGGLSPSLDTLDNIR+LDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA+QFNHTNGLSLISRAHQLVMEG+NWCQ+KNVVTVFSAPNYCYRCGNMAAILEIGENM+QNFLQFDPAPRQ+EP+TTRKTPD
Sbjct:  156 LIESQVFCLHGGLSPSLDTLDNIRSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIATQFNHTNGLSLISRAHQLVMEGFNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQVEPETTRKTPD 304          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A1_ARATH (Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=2 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 1.969e-84
Identity = 142/149 (95.30%), Postives = 147/149 (98.66%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIESQ+FCLHGGLSPSLDTLDNIR+LDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA+QFNH NGLSLISRAHQLVMEGYNWCQ+KNVVTVFSAPNYCYRCGNMAAILEIGE MEQNFLQFDPAPRQ+EPDTTRKTPD
Sbjct:  155 LIESQVFCLHGGLSPSLDTLDNIRSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIATQFNHNNGLSLISRAHQLVMEGYNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGEKMEQNFLQFDPAPRQVEPDTTRKTPD 303          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A_HEVBR (Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.358e-84
Identity = 144/149 (96.64%), Postives = 147/149 (98.66%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA+QFNHTNGL+LISRAHQLVMEGYNWCQ+KNVVTVFSAPNYCYRCG MAAILEIGENM QNFLQFDPAPRQIEPDTTRKTPD
Sbjct:  155 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHTNGLTLISRAHQLVMEGYNWCQEKNVVTVFSAPNYCYRCGIMAAILEIGENMAQNFLQFDPAPRQIEPDTTRKTPD 303          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A_HELAN (Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.407e-82
Identity = 138/149 (92.62%), Postives = 145/149 (97.32%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIA+QFNHTNGLSLISRAHQLVMEGYNW Q+ NVVT+FSAPNYCYRCGNMAAILE+GENM+QNFLQFDPAPRQ+EPD  R+TPD
Sbjct:  154 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHTNGLSLISRAHQLVMEGYNWSQENNVVTIFSAPNYCYRCGNMAAILEVGENMDQNFLQFDPAPRQVEPDVARRTPD 302          
BLAST of CN188640 vs. ExPASy Swiss-Prot
Match: PP2A2_ERYGR (Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Erysiphe graminis subsp. hordei GN=PP2A-2 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 7.760e-73
Identity = 121/149 (81.21%), Postives = 136/149 (91.28%), Query Frame = 2
Query:    5 LIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPD 451
            LIE+QIFCLHGGLSPS+DTLDNI++LDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDI+  FNH NGL+L++RAHQLVMEGYNW QD+NVVT+FSAPNYCYRCGN AAI+EI E+++  FLQFDP PR  EP  TR+TPD
Sbjct:  177 LIENQIFCLHGGLSPSIDTLDNIKSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEAFNHNNGLTLVARAHQLVMEGYNWSQDRNVVTIFSAPNYCYRCGNQAAIMEIDEHLKYTFLQFDPCPRAGEPMVTRRTPD 325          
The following BLAST results are available for this feature:
BLAST of CN188640 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 190
Match NameE-valueIdentityDescription
PP2A3_ORYSJ2.326e-8596.64Serine/threonine-protein phosphatase PP2A-3 cataly... [more]
PP2A3_ORYSI2.326e-8596.64Serine/threonine-protein phosphatase PP2A-3 cataly... [more]
PP2A2_ARATH3.967e-8595.97Serine/threonine-protein phosphatase PP2A-2 cataly... [more]
PP2A1_ORYSJ6.767e-8595.30Serine/threonine-protein phosphatase PP2A-1 cataly... [more]
PP2A1_ORYSI6.767e-8595.30Serine/threonine-protein phosphatase PP2A-1 cataly... [more]
PP2A5_ARATH1.969e-8494.63Serine/threonine-protein phosphatase PP2A-5 cataly... [more]
PP2A1_ARATH1.969e-8495.30Serine/threonine-protein phosphatase PP2A-1 cataly... [more]
PP2A_HEVBR3.358e-8496.64Serine/threonine-protein phosphatase PP2A catalyti... [more]
PP2A_HELAN2.407e-8292.62Serine/threonine-protein phosphatase PP2A catalyti... [more]
PP2A2_ERYGR7.760e-7381.21Serine/threonine-protein phosphatase PP2A-2 cataly... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006H18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006H18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188640 ID=CN188640; Name=CN188640; organism=Citrus sinensis; type=EST; length=702bp
ACGTCTTATTGAGAGTCAGATCTTCTGTTTGCATGGAGGACTTTCACCAT
CTTTGGATACACTAGATAACATTAGGGCCCTGGACCGAATACAGGAGGTT
CCACATGAAGGACCCATGTGCGATCTCTTGTGGTCTGATCCAGATGACCG
CTGTGGGTGGGGAATATCTCCCCGTGGTGCGGGCTATACATTTGGGCAGG
ATATAGCATCTCAGTTCAACCACACCAACGGACTCAGTCTTATTTCAAGA
GCCCACCAGCTTGTCATGGAAGGATACAATTGGTGTCAGGATAAGAATGT
GGTGACTGTATTTAGTGCTCCTAACTATTGTTACCGATGTGGGAATATGG
CTGCAATTTTAGAGATTGGGGAGAATATGGAGCAGAATTTTCTCCAATTT
GATCCAGCACCACGGCAAATAGAGCCTGACACCACGCGCAAGACGCCTGA
TTATTTTTTGTAATTTCAATATTTCCACCATCTGTTTGTAATTCATGTTT
GTTTACCTACCAGGTAGATGTGTCCTTAAAAAGGAGGAGCTTTTGTTGTT
TAAGTTGAGGTTACAACATCATTCTTTTGTTTCGAGTTTTGCCCTACTAC
TGCTTTGTTGATGTGCTGAAGGAGTCCATAGGAGTACTGACAGAAGGCAT
CAATGGCCTGTTGTCTTGTATATTGTCTAAGTGGGCGGCAATAACATGTT
AT
back to top