CN181496

Overview
NameCN181496
Unique NameCN181496
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12923 contig Csv1_Contig12923:24..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 236.884 bits (603), Expect = 7.140e-62
Identity = 108/174 (62.07%), Postives = 130/174 (74.71%), Query Frame = 1
Query:  145 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            +L  IIS   FDD+L++RND  CPARGFYTY+AFI AA++FPGFG +G+   RK+E+AAFF QT HETTGGW  AP G Y+WGYCF  E +P SDYC+P+  +PC    +YYGRGP+QLSWNYNY  C           NNPDL+A D V++FK+AIWFWMTAQPPKPSCH VI
Sbjct:   85 DLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLC--GRAIGVDLLNNPDLVANDAVIAFKAAIWFWMTAQPPKPSCHAVI 256          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 7.140e-62
Identity = 108/174 (62.07%), Postives = 129/174 (74.14%), Query Frame = 1
Query:  145 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            +L  IISR  FDD+L++RND  CPARGFYTYDAFI AA++FPGFG +G+   RK+EIAAFF QT HETTGGW  AP G Y+WGYCF  E +P S+YC P+  +PC     YYGRGP+QLSWNYNY +C           NNPDL++ DPV++FK+AIWFWMT Q PKPSCH VI
Sbjct:   70 DLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQC--GRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTPQSPKPSCHAVI 241          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 4.628e-61
Identity = 108/171 (63.16%), Postives = 129/171 (75.44%), Query Frame = 1
Query:  154 KIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            KIISR MFD +L++RN+  CPA+GFYTYDAF+ AA++FP FG +G+  +RKRE+AAF  QT HETTGGWP AP G YAWGYCF+ E +P S+YC   P YPC  GK YYGRGP+QLSWNYNY  C            NPDL+ATD VLSFK+A+WFWMT Q PKPSCH+V+
Sbjct:    4 KIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRYPCAPGKSYYGRGPLQLSWNYNYGPC--GEALRVNLLGNPDLVATDRVLSFKTALWFWMTPQAPKPSCHDVL 172          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 6.044e-61
Identity = 109/174 (62.64%), Postives = 129/174 (74.14%), Query Frame = 1
Query:  145 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            +LG IIS  MFD +L++RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC++ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VI
Sbjct:   74 DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVI 245          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 6.044e-61
Identity = 109/174 (62.64%), Postives = 129/174 (74.14%), Query Frame = 1
Query:  145 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            +LG IIS  MFD +L++RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC++ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VI
Sbjct:   79 DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVI 250          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.140e-59
Identity = 110/197 (55.84%), Postives = 135/197 (68.53%), Query Frame = 1
Query:   76 SAQNCGSGVVYXXXXXXXXXXXXELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            +A  CGSG               ++G++I+R MF+D+L++RN+  CP +GFYTYDAFI AA+AFPGFG +G+ T RKREIAAF AQT HETTGGW  AP G YAWGYC++ E   P  YC P+  +PC    KYYGRGPIQ+S+NYNY +            NNPDL+ATD V+SFK+A WFWMT Q PKPSCH VI
Sbjct:   47 TADYCGSGC------QSQCSSTGDIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAFLAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGAYCVPSAQWPCAAGRKYYGRGPIQISYNYNYGQA--GKAIGVDLVNNPDLVATDAVISFKTAFWFWMTPQSPKPSCHNVI 235          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHI1_SOLTU (Endochitinase 1 (Fragment) OS=Solanum tuberosum GN=CHTB1 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.332e-59
Identity = 109/175 (62.29%), Postives = 127/175 (72.57%), Query Frame = 1
Query:  145 ELGKIISREMFDDLLEYRNDERCPARG-FYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            +LG +IS  MFD +L +RND  C  +G FY+Y+AFI AA +FPGFG +G+ T RKREIAAFFAQT HETTGGWP AP G YAWGYCF+ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATD V+SFKSAIWFWMT Q PKPSCH+VI
Sbjct:   67 DLGGVISNSMFDQMLNHRNDNACQGKGNFYSYNAFISAAGSFPGFGTTGDITARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSSQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDSVISFKSAIWFWMTPQSPKPSCHDVI 239          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHI4_SOLTU (Endochitinase 4 (Fragment) OS=Solanum tuberosum GN=CHTB4 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 5.657e-59
Identity = 107/175 (61.14%), Postives = 128/175 (73.14%), Query Frame = 1
Query:  145 ELGKIISREMFDDLLEYRNDERCPARG-FYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            ++G +IS  MFD +L++RND  C  +  FY+Y+AFI AA++F GFG +G+ T RKREIAAFFAQT HETTGGWP AP G YAWGYCF+ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSAIWFWMT Q PKPSCH+VI
Sbjct:   77 DIGSVISNSMFDQMLKHRNDNACQGKNNFYSYNAFINAARSFGGFGTTGDTTARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDPVISFKSAIWFWMTPQSPKPSCHDVI 249          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 7.389e-59
Identity = 111/175 (63.43%), Postives = 129/175 (73.71%), Query Frame = 1
Query:  148 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            L  +ISRE F+ +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+  E++PPS YC  DPNYPC  GK Y+GRGP+QLSWNYNY +C           NNPDLL++DP +SFKSA WFWMT Q PKPSCH VI
Sbjct:   52 LTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQC--GRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVI 223          
BLAST of CN181496 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 7.389e-59
Identity = 111/175 (63.43%), Postives = 129/175 (73.71%), Query Frame = 1
Query:  148 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVI 654
            L  +ISRE F+ +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+  E++PPS YC  DPNYPC  GK Y+GRGP+QLSWNYNY +C           NNPDLL++DP +SFKSA WFWMT Q PKPSCH VI
Sbjct:   74 LTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQC--GRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVI 245          
The following BLAST results are available for this feature:
BLAST of CN181496 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHIB_ARATH7.140e-6262.07Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI2_BRANA7.140e-6262.07Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHIT_CARPA4.628e-6163.16Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI2_TOBAC6.044e-6162.64Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHI1_TOBAC6.044e-6162.64Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHIB_VITVI1.140e-5955.84Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI1_SOLTU4.332e-5962.29Endochitinase 1 (Fragment) OS=Solanum tuberosum GN... [more]
CHI4_SOLTU5.657e-5961.14Endochitinase 4 (Fragment) OS=Solanum tuberosum GN... [more]
CHI2_GOSHI7.389e-5963.43Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI1_GOSHI7.389e-5963.43Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A14_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181496 ID=CN181496|Name=CN181496|organism=Citrus sinensis|type=EST|length=656bp
GAGGGTTGCTTTCAAATGAGGCTTATTGGGTCCTTACTAATTTTCTCTCT
AGTTTTATCTTTTGTACTAGGAGGCTCAGCACAGAACTGTGGAAGCGGCG
TTGTGTACGGTGGACGTGATACCGGCCATGGGACGCATGGCGGTGAACTG
GGCAAGATCATCTCAAGGGAGATGTTTGATGACTTGCTTGAGTATAGAAA
TGATGAACGATGCCCTGCCAGAGGCTTCTACACTTATGATGCTTTTATAG
AGGCAGCCCAAGCTTTTCCAGGCTTTGGTAACTCTGGAAATGAAACCATG
CGTAAAAGAGAAATCGCTGCCTTTTTTGCCCAAACTGGCCATGAAACTAC
TGGGGGATGGCCCGATGCACCTGGTGGCGAATATGCTTGGGGATATTGCT
TTATAAGCGAAGTTAGCCCTCCGTCCGACTACTGTGATCCTAACTATCCA
TGTCGAGGGAAGTACTATGGCCGAGGTCCAATTCAACTCTCTTGGAATTA
CAATTACTTACGGTGCGGAGAAGGCCTAGGGCTAGGAGAGGAGTTGTTGA
ACAATCCAGACCTTCTTGCTACTGATCCAGTACTATCATTCAAGTCAGCA
ATCTGGTTCTGGATGACTGCACAGCCACCAAAGCCATCGTGCCACGAAGT
CATTAT
back to top