CN181493

Overview
NameCN181493
Unique NameCN181493
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length638
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9664 contig Csv1_Contig9664:814..1451. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_MACFA (Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.754e-39
Identity = 69/137 (50.36%), Postives = 101/137 (73.72%), Query Frame = -2
Query:  218 TPKCVRKCVKK-NQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 625
            TPKC + C    +  ++  KHY  ++Y +++  +DIMAEIYKNGPVE +F+VY DF  YKSGVY+H+TG++MGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG + CGIE +VVAG+P +    ++I
Sbjct:  204 TPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 339          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_HUMAN (Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3)

HSP 1 Score: 161.77 bits (408), Expect = 2.754e-39
Identity = 69/137 (50.36%), Postives = 101/137 (73.72%), Query Frame = -2
Query:  218 TPKCVRKCVKK-NQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 625
            TPKC + C    +  ++  KHY  ++Y +++  +DIMAEIYKNGPVE +F+VY DF  YKSGVY+H+TG++MGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG + CGIE +VVAG+P +    ++I
Sbjct:  204 TPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 339          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_PONAB (Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.597e-39
Identity = 69/137 (50.36%), Postives = 100/137 (72.99%), Query Frame = -2
Query:  218 TPKCVRKCVKK-NQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 625
            TPKC + C    +  ++  KHY  ++Y +++   DIMAEIYKNGPVE +F+VY DF  YKSGVY+H+TG++MGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG + CGIE +VVAG+P +    ++I
Sbjct:  204 TPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSERDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 339          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_PIG (Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.697e-39
Identity = 68/128 (53.12%), Postives = 95/128 (74.22%), Query Frame = -2
Query:  245 TPKCVRKCVKK-NQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 625
            TPKC + C       ++  KH+  S+Y I+ + ++IMAEIYKNGPVE +FTVY DF  YKSGVY+H+TGD+MGGHA++++GWG  ++G  YW++ N WN  WG +G+FKI RG + CGIE ++VAG+P
Sbjct:  204 TPKCSKICEPGYTPSYKEDKHFGCSSYSISRNEKEIMAEIYKNGPVEGAFTVYSDFLQYKSGVYQHVTGDLMGGHAIRILGWGV-ENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGIP 330          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_RAT (Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.135e-39
Identity = 69/131 (52.67%), Postives = 96/131 (73.28%), Query Frame = -2
Query:  236 TPKCVRKC-VKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSK 625
            TPKC + C    +  ++  KHY  ++Y ++   ++IMAEIYKNGPVE +FTV+ DF  YKSGVYKH  GDVMGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG N CGIE ++VAG+P ++
Sbjct:  204 TPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGI-ENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQ 333          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CPR4_CAEEL (Cathepsin B-like cysteine proteinase 4 OS=Caenorhabditis elegans GN=cpr-4 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 3.976e-38
Identity = 70/131 (53.44%), Postives = 90/131 (68.70%), Query Frame = -2
Query:  245 YPTPKCVRKCVKKNQ--LWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 631
            Y TP CV KC  KN    +   KH+  +AY +      I AEI  +GPVE +FTVYEDF  YK+GVY H TG  +GGHA++++GWGT D+G  YW++AN WN +WG +GYF+I RG+NECGIE  VV G+P
Sbjct:  204 YDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVSQIQAEIIAHGPVEAAFTVYEDFYQYKTGVYVHTTGQELGGHAIRILGWGT-DNGTPYWLVANSWNVNWGENGYFRIIRGTNECGIEHAVVGGVP 333          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_MOUSE (Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 8.859e-38
Identity = 66/128 (51.56%), Postives = 94/128 (73.44%), Query Frame = -2
Query:  245 TPKCVRKC-VKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 625
            TP+C + C    +  ++  KH+  ++Y +++  ++IMAEIYKNGPVE +FTV+ DF  YKSGVYKH  GD+MGGHA++++GWG  ++G  YW+ AN WN  WG +G+FKI RG N CGIE ++VAG+P
Sbjct:  204 TPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGV-ENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIP 330          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_BOVIN (Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5)

HSP 1 Score: 156.377 bits (394), Expect = 1.157e-37
Identity = 64/128 (50.00%), Postives = 96/128 (75.00%), Query Frame = -2
Query:  245 TPKCVRKCVKK-NQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 625
            TPKC + C    +  ++  KH+  S+Y + ++ ++IMAEIYKNGPVE +F+VY DF  YKSGVY+H++G++MGGHA++++GWG  ++G  YW++ N WN  WG +G+FKI RG + CGIE ++VAG+P
Sbjct:  204 TPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGV-ENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMP 330          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CPR5_CAEEL (Cathepsin B-like cysteine proteinase 5 OS=Caenorhabditis elegans GN=cpr-5 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.973e-37
Identity = 70/131 (53.44%), Postives = 86/131 (65.65%), Query Frame = -2
Query:  245 PTPKCVRKCVKKNQL---WRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 628
            PTPKCV  C  KN     +   KH+  +AY +    E I  EI  NGP+EV+FTVYEDF  Y +GVY H  G  +GGHAVK++GWG  D+G  YW++AN WN +WG  GYF+I RG NECGIE   VAG+P
Sbjct:  209 PTPKCVDSCTSKNNYATPYLQDKHFGSTAYAVGKKVEQIQTEILTNGPIEVAFTVYEDFYQYTTGVYVHTAGASLGGHAVKILGWGV-DNGTPYWLVANSWNVAWGEKGYFRIIRGLNECGIEHSAVAGIP 338          
BLAST of CN181493 vs. ExPASy Swiss-Prot
Match: CATB_CHICK (Cathepsin B OS=Gallus gallus GN=CTSB PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.577e-37
Identity = 66/128 (51.56%), Postives = 93/128 (72.66%), Query Frame = -2
Query:  245 TPKCVRKCVKK-NQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 625
            TP+C R C    +  ++  KHY I++Y +    ++IMAEIYKNGPVE +F VYEDF  YKSGVY+H++G+ +GGHA++++GWG  ++G  YW+ AN WN  WG  G+FKI RG + CGIE ++VAG+P
Sbjct:  205 TPRCSRHCEPGYSPSYKEDKHYGITSYGVPRSEKEIMAEIYKNGPVEGAFIVYEDFLMYKSGVYQHVSGEQVGGHAIRILGWGV-ENGTPYWLAANSWNTDWGITGFFKILRGEDHCGIESEIVAGVP 331          
The following BLAST results are available for this feature:
BLAST of CN181493 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 61
Match NameE-valueIdentityDescription
CATB_MACFA2.754e-3950.36Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV... [more]
CATB_HUMAN2.754e-3950.36Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3[more]
CATB_PONAB3.597e-3950.36Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1[more]
CATB_PIG4.697e-3953.13Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1[more]
CATB_RAT6.135e-3952.67Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2[more]
CPR4_CAEEL3.976e-3853.44Cathepsin B-like cysteine proteinase 4 OS=Caenorha... [more]
CATB_MOUSE8.859e-3851.56Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2[more]
CATB_BOVIN1.157e-3750.00Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5[more]
CPR5_CAEEL1.973e-3753.44Cathepsin B-like cysteine proteinase 5 OS=Caenorha... [more]
CATB_CHICK2.577e-3751.56Cathepsin B OS=Gallus gallus GN=CTSB PE=2 SV=1[more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A12_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181493 ID=CN181493|Name=CN181493|organism=Citrus sinensis|type=EST|length=638bp
GAGGTTTTTTATTACAACTGGTTCTATTTTTACACACAACATTAAACTCC
ATTAATACATTCAATTATGCAAGACGGGAGCTTCCCATTTCATGCCTTGA
TAGCTTAGGTTCAACGATACACCCCTATAGCTACACATTTGATATATAAA
TAACAACATGAAGGTATAGCAAAGTCTGCTCTCAAGCTGAAGCATCCTCA
AACATATCTGCACTTGTAATCTCTTTGACAAGATTTTTGGATGAAGGCAA
ACCAGCAACCACATCCTCTTCAATACCACACTCATTTGATCCTCTTTTAA
TCTTGAAGTAACCATCCGCACCCCAGCTTCTATTCCACTGATTAGCGAGA
ATCCAGTAATCCTCGCCATCATCACTAGTTCCCCAACCAATAAGCTTAAC
AGCATGACCCCCCATTACATCGCCTGTGATGTGTTTGTAGACCCCAGATT
TGTAGTGAGCAAAATCCTCATAAACTGTGAAGGAAACTTCAACTGGTCCA
TTCTTGTAAATTTCTGCCATTATGTCCTCTGGATCAGAATTGATTCTATA
TGCACTAATACTGTAGTGCTTTGAATTCCTCCAAAGCTGGTTTTTCTTGA
CGCACTTCCTCACACACTTTGGAGTAGGATATGCCGGC
back to top