CN181490

Overview
NameCN181490
Unique NameCN181490
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length571
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN181490 vs. ExPASy Swiss-Prot
Match: PLST2_ARATH (Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.146e-19
Identity = 49/70 (70.00%), Postives = 53/70 (75.71%), Query Frame = -1
Query:  362 RAKAMAVCMSVHWVINFFVGXXXXXXXXXXXXXXLYSIFGTFCLMAVAFVKRNVVETKGKSLQEIEIALL 571
            RAKAMA CMSVHWVINFFVG              LYS+F TFCLMAV FVKRNV+ETKGK+LQEIEI+LL
Sbjct:  421 RAKAMAFCMSVHWVINFFVGLLFLRLLEKLGPRLLYSMFSTFCLMAVMFVKRNVIETKGKTLQEIEISLL 490          
BLAST of CN181490 vs. ExPASy Swiss-Prot
Match: PLST3_ARATH (Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 3.451e-16
Identity = 43/70 (61.43%), Postives = 52/70 (74.29%), Query Frame = -1
Query:  362 RAKAMAVCMSVHWVINFFVGXXXXXXXXXXXXXXLYSIFGTFCLMAVAFVKRNVVETKGKSLQEIEIALL 571
            RA A+AVC++VHWVINFFVG              L +IFG FC++AV FV++NVVETKGKSLQEIEI+LL
Sbjct:  422 RATALAVCLAVHWVINFFVGLLFLRMLEQLGSVLLNAIFGFFCVVAVIFVQKNVVETKGKSLQEIEISLL 491          
The following BLAST results are available for this feature:
BLAST of CN181490 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PLST2_ARATH1.146e-1970.00Probable plastidic glucose transporter 2 OS=Arabid... [more]
PLST3_ARATH3.451e-1661.43Probable plastidic glucose transporter 3 OS=Arabid... [more]
back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A11_f Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181490 ID=CN181490|Name=CN181490|organism=Citrus sinensis|type=EST|length=571bp
CAGCACTCAACATCATATAGGAACAATATGCATTTCATACACCAGTTATG
AATATTAAGGGCAGTACATATTTAAGACTATATGTAATCACAAATCAAAG
CTTCAAAAAGGCCAGGCCTGCCCGTGCTGAAATTTGACCAGTGAAATAAA
GGCTAGATCACACTCCACTAGAACTCATATGCAGCATTTACCCGATCATA
TTTGTAGATATGCAAGGGTTTTCCAATCGACAATTCTAACATTCTGGTAT
CTCATCTTGCTTCAGCCGCACGAATACCTTTTATCAGATAAGCAACACTT
GCTTACATCTGTTATACTGAAGTTTCTTTAAACAGGAAAATAACTTCCAT
TATTCCTGCGGAAGAAGAGCTATCTCAATTTCTTGGAGTGATTTTCCTTT
GGTTTCCACAACATTTCTTTTTACAAAAGCCACTGCCATTAAGCAAAAGG
TTCCAAATATAGAATACAAGAGCTGTGGCCCTAGTTGCTCCAACAGTCGC
AAAAACAGCAGGCCCACAAAGAAATTTATCACCCAGTGTACTGACATACA
CACTGCCATTGCTTTTGCTCT
back to top