CN181489

Overview
NameCN181489
Unique NameCN181489
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length667
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2265 contig Csv1_Contig2265:607..1273. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: ACCH1_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.532e-43
Identity = 88/199 (44.22%), Postives = 126/199 (63.32%), Query Frame = -3
Query:   72 EEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXLKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFFSP--SERDSLYGPFPELISPEKPARFRQFTHTDYITRFFTKQLDGKTLVNYYRL 662
            E++P  C +  +E++  V +              L T+ LK+       +++GHYYP CPQPDLT+G+T H+D   LTILLQD  GGLQ+ H + WVDV PVPGALV+N+GD+LQ+++ND++ISVEHRVLAN +  PRIS+A FFS        +YGP  E++S E P  +R  T T+Y   + +K  DG + + Y ++
Sbjct:  168 EDLPATCGEMMIEYSKEVMKLGKLLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTILLQDHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANVA-GPRISVACFFSSYLMANPRVYGPIKEILSEENPPNYRDTTITEYAKFYRSKGFDGTSGLLYLKI 365          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: DV4H_CATRO (Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 1.570e-40
Identity = 88/203 (43.35%), Postives = 127/203 (62.56%), Query Frame = -3
Query:   72 EEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXLKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFFSPSERDS------LYGPFPELISPEKPARFRQFTHTDYITRFFTKQLDGKTLVNYYRL 662
            +E P++CR   ++++++V+               LK + L+E    EG +++GHYYP CPQP+LT G + H+D G LTIL+QD  GGLQI    +W+DV  +PGALVINI D+LQ+++ND++ SVEHRVLAN    PRIS+AV F    +        LYGP  ELIS E P  +++ T  D+IT  F K+ D  + ++ +RL
Sbjct:  198 QEFPDVCRDILMKYSNYVRNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPACPQPELTFGTSKHSDSGFLTILMQDQIGGLQILLENQWIDVPFIPGALVINIADLLQLITNDKFKSVEHRVLAN-KVGPRISVAVAFGIKTQTQEGVSPRLYGPIKELISEENPPIYKEVTVKDFITIRFAKRFDDSSSLSPFRL 399          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: ACCH3_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.569e-40
Identity = 81/199 (40.70%), Postives = 124/199 (62.31%), Query Frame = -3
Query:   72 EEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXLKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFFSPSERDS--LYGPFPELISPEKPARFRQFTHTDYITRFFTKQLDGKTLVNYYRL 662
            +++PEICR   +E++  V                L+ + L +    +G +M+ HYYP CP+PDLT+G + H+D   LT+LL D   GLQ++    W DV  V GAL+INIGD+LQ+++ND++IS+EHRVLAN +   R+S+A FF+   R +  +YGP  EL+S E P ++R+ T  DY T F  K LDG + + ++++
Sbjct:  171 QDLPEICRDIMMEYSKQVMNLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHSDNSFLTVLLPDQIEGLQVRREGHWFDVPHVSGALIINIGDLLQLITNDKFISLEHRVLANRATRARVSVACFFTTGVRPNPRMYGPIRELVSEENPPKYRETTIKDYATYFNAKGLDGTSALLHFKI 369          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: ACCH3_SOLLC (1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.625e-37
Identity = 82/200 (41.00%), Postives = 118/200 (59.00%), Query Frame = -3
Query:   72 LEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXLKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFF--SPSERDSLYGPFPELISPEKPARFRQFTHTDYITRFFTKQLDGKTLVNYYRL 665
            L+E P  C +  ++++  VK+              L    LK+           +YYP CPQP+LT+G   HTD G +TILLQDD GGLQ+ H   WVDV P PG+LV+NIGD LQ++SND+Y+SVEHR ++N+    R+SI  FF  SP +   LYGP  EL+S + P ++R  T  D+ +    + LDG + ++ Y++
Sbjct:  165 LQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGTIQHTDIGFVTILLQDDMGGLQVLHQNHWVDVPPTPGSLVVNIGDFLQLLSNDKYLSVEHRAISNNVGS-RMSITCFFGESPYQSSKLYGPITELLSEDNPPKYRATTVKDHTSYLHNRGLDGTSALSRYKI 363          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: ACCH2_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 6.176e-37
Identity = 82/192 (42.71%), Postives = 117/192 (60.94%), Query Frame = -3
Query:   99 EEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXLKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFF----SPSERDSLYGPFPELISPEKPARFRQFTHTDYITRFFTKQLDG 662
            +++PEICR   +E++  V                L  + LK+   L+G  M+ HY+P CP+PDLT G + H+D   LT+LL D+  GLQ+     W DV  VPGAL+INIGD+LQ+++ND++IS++HRVLAN +   R+S+A FF     P+ R  +YGP  EL+S E P ++R+ T  DY T F  K L G
Sbjct:  171 QDLPEICRDVMMEYSKQVMILGEFLFELLSEALGLNPNHLKDMECLKGLRMLCHYFPPCPEPDLTFGTSKHSDGSFLTVLLPDNIEGLQVCREGYWFDVPHVPGALIINIGDLLQLITNDKFISLKHRVLANRATRARVSVACFFHTHVKPNPR--VYGPIKELVSEENPPKYRETTIRDYATYFNGKGLGG 360          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: GSL_ARATH (Probable 2-oxoacid dependent dioxygenase OS=Arabidopsis thaliana GN=GSL-OH PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.682e-34
Identity = 76/202 (37.62%), Postives = 120/202 (59.41%), Query Frame = -3
Query:   72 EEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXLKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFF-----SPSERDSLYGPFPELISPEKPARFRQFTHTDYITRFFTKQLDGKTLVNYYRL 662
            +++PE+C +  +E++  V +              L  + LKE    +G  M+ H +P CP+P+ T G   HTD   LTILL D+ GGLQ+ +   W+DV P P AL+ N+GD LQ++SND+++S+EHR+LAN   EPRIS+A FF     SPS R  +YGP  EL+S   P ++R  T ++    +  ++ +G + +++ R+
Sbjct:  161 QDLPEVCGEIMLEYSKEVMKLAELMFEILSEALGLSPNHLKEMDCAKGLWMLCHCFPPCPEPNRTFGGAQHTDRSFLTILLNDNNGGLQVLYDGYWIDVPPNPEALIFNVGDFLQLISNDKFVSMEHRILANGGEEPRISVACFFVHTFTSPSSR--VYGPIKELLSELNPPKYRD-TTSESSNHYVARKPNGNSSLDHLRI 359          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.012e-28
Identity = 64/145 (44.14%), Postives = 94/145 (64.83%), Query Frame = -3
Query:   72 HYYPYCPQPDLTVGITSHTDPGPLTILLQ-DDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFFSPSERDSLYGPFPELISPEKPARFRQFTHTDYITRFFTKQLDGKTLVNYYRL 503
            +YYP CPQPD  +G+T H+D   LT+L+Q +D  GLQIK   +WV VKP+P A ++NIGD+L+I++N  Y S+EHR + NS  E R+SIA F +      + GP   L+  +K ARF++ T  +Y    F++ LDGK  ++  R+
Sbjct:  216 NYYPPCPQPDQVIGLTPHSDSVGLTVLMQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVNSEKE-RLSIATFHNVGMYKEV-GPAKSLVERQKVARFKRLTMKEYNDGLFSRTLDGKAYLDALRI 358          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: ACCO1_ARATH (1-aminocyclopropane-1-carboxylate oxidase OS=Arabidopsis thaliana GN=ACO PE=2 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.864e-25
Identity = 61/139 (43.88%), Postives = 86/139 (61.87%), Query Frame = -3
Query:   96 YPYCPQPDLTVGITSHTDPGPLTILLQDDK-GGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFFSPSERDSLYGPFPELI----SPEKPARFRQFTHTDYITRFFTKQLDGK 497
            YP CP PDL  G+ +HTD G + +L QDDK  GLQ+    EWVDV PV  ++V+N+GD L++++N +Y SVEHRVL+ +  E R+SIA F++P   DS+  P PELI      EK   + +F   DY+  +   +   K
Sbjct:  162 YPPCPNPDLVKGLRAHTDAGGIILLFQDDKVSGLQLLKDGEWVDVPPVKHSIVVNLGDQLEVITNGKYKSVEHRVLSQTDGEGRMSIASFYNPGS-DSVIFPAPELIGKEAEKEKKENYPRFVFEDYMKLYSAVKFQAK 299          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: FLS_PETCR (Flavonol synthase/flavanone 3-hydroxylase OS=Petroselinum crispum GN=FLS PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.208e-24
Identity = 56/129 (43.41%), Postives = 83/129 (64.34%), Query Frame = -3
Query:  129 MMVGHYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFFSPSERDSLYGPFPELISPEKPARFRQFTHTDYI 515
            M+  +YYP CP+PDL +G+ +HTD   +TIL+ ++  GLQ+   + W DVK +P AL+I+IGD ++IMSN +Y SV HR   N   + R+S  VF  P   + L GP  +LI+ E PA+F+   + DY+
Sbjct:  202 MLKINYYPPCPRPDLALGVVAHTDMSAITILVPNEVQGLQVHKDDHWYDVKYIPNALIIHIGDQIEIMSNGKYKSVYHRTTVNKD-KTRMSWPVFLEPPP-ELLTGPISKLITDENPAKFKTKKYKDYV 328          
BLAST of CN181489 vs. ExPASy Swiss-Prot
Match: LDOX_MAIZE (Leucoanthocyanidin dioxygenase OS=Zea mays GN=A2 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.830e-24
Identity = 55/132 (41.67%), Postives = 76/132 (57.58%), Query Frame = -3
Query:  108 HYYPYCPQPDLTVGITSHTDPGPLTILLQDDKGGLQIKHGEEWVDVKPVPGALVINIGDILQIMSNDEYISVEHRVLANSSPEPRISIAVFFSPSERDSLYGPFPELISPEKPARFRQFTHTDYITRFFTKQ 503
            +YYP CPQP+L VG+ +HTD   L+ +L +   GLQ+ HG  WV  +  PG +++++GD L+I+SN  Y SV HR L N     RIS  VF  P     L  P PEL++   PARF   T   ++ R   K+
Sbjct:  237 NYYPRCPQPELAVGVEAHTDVSALSFILHNGVPGLQVLHGARWVTARHEPGTIIVHVGDALEILSNGRYTSVLHRGLVNRE-AVRISWVVFCEPPPDSVLLHPLPELVTEGHPARFTPRTFKQHLDRKLFKK 367          
The following BLAST results are available for this feature:
BLAST of CN181489 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ACCH1_ARATH7.532e-4344.221-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
DV4H_CATRO1.570e-4043.35Deacetoxyvindoline 4-hydroxylase OS=Catharanthus r... [more]
ACCH3_ARATH4.569e-4040.701-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
ACCH3_SOLLC1.625e-3741.001-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
ACCH2_ARATH6.176e-3742.711-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
GSL_ARATH1.682e-3437.62Probable 2-oxoacid dependent dioxygenase OS=Arabid... [more]
SRG1_ARATH4.012e-2844.14Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
ACCO1_ARATH1.864e-2543.881-aminocyclopropane-1-carboxylate oxidase OS=Arabi... [more]
FLS_PETCR1.208e-2443.41Flavonol synthase/flavanone 3-hydroxylase OS=Petro... [more]
LDOX_MAIZE7.830e-2441.67Leucoanthocyanidin dioxygenase OS=Zea mays GN=A2 P... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A10_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181489 ID=CN181489|Name=CN181489|organism=Citrus sinensis|type=EST|length=667bp
GAATTGTTATTCTTACGTAAGAATAGTTTATACAGGCACAAACAACCAGA
TTTACCAAGTTTTGTTTCTTACAGCCTATAGTAATTCACCAATGTTTTTC
CATCTAACTGTTTTGTGAAGAACCTTGTTATATAGTCCGTGTGTGTGAAC
TGCCGAAAACGAGCTGGCTTCTCTGGGGATATCAGCTCCGGGAATGGTCC
ATAAAGGCTGTCCCTCTCGCTTGGACTGAAGAAAACAGCAATTGAGATTC
GTGGTTCCGGGGACGAATTAGCCAATACTCTATGCTCTACACTTATGTAT
TCATCATTGGACATAATCTGAAGTATATCCCCAATGTTAATAACCAGAGC
TCCTGGAACTGGTTTAACATCCACCCATTCCTCACCATGCTTAATTTGCA
GCCCACCTTTATCATCTTGCAACAAGATTGTCAATGGCCCTGGATCAGTA
TGAGATGTGATCCCCACTGTCAGATCAGGCTGCGGACAGTAGGGATAATA
ATGGCCCACCATCATCCTCCCTTCCAGGAAGGTCTTTTCCTTCAACCTAT
CGGTTTTCAACCCCAAACCTTCACACAGCAGCCCAAACAAAAGCTCTCCG
AGCTGTTTTACATGGTGGTTCCACTCGACTGCCTCTTTCCTACATATTTC
AGGAACTTCTTCAAGCT
back to top