CN181488

Overview
NameCN181488
Unique NameCN181488
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length649
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2265 contig Csv1_Contig2265:66..714. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181488 vs. ExPASy Swiss-Prot
Match: GSL_ARATH (Probable 2-oxoacid dependent dioxygenase OS=Arabidopsis thaliana GN=GSL-OH PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.425e-30
Identity = 66/180 (36.67%), Postives = 107/180 (59.44%), Query Frame = 1
Query:   64 ESYDRAKPLKRSDDSXXXXXXXXXXXXTAIPRFYIHPPATLADLRPKSKTRPVSDVVPTIDLSGV-DSDDLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPDIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHV 600
            E+YDRA  LK  D+             T +PR + +P   +A+ +P S       ++PTIDL GV +S  +R ++V K+  A  + GFFQ +NHG+ ++V+E+M+  I+ FH+Q P+++   Y R+ TK + Y SN DL+ S AASWRDTL   +    P+ +++PE+C +  +E++  V
Sbjct:    3 ENYDRASELKAFDEMKIGVKGLVDAGVTKVPRIFHNPHVNVANPKPTSTVV----MIPTIDLGGVFESTVVRESVVAKVKDAMEKFGFFQAINHGVPLDVMEKMINGIRRFHDQDPEVRKMFYTRDKTKKLKYHSNADLYESPAASWRDTLSCVMAPDVPKAQDLPEVCGEIMLEYSKEV 178          
BLAST of CN181488 vs. ExPASy Swiss-Prot
Match: ACCH2_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.742e-28
Identity = 65/180 (36.11%), Postives = 100/180 (55.56%), Query Frame = 1
Query:   67 SYDRAKPLKRSDDSXXXXXXXXXXXXTAIPRFYIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL--RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPDIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHV 600
            S+DRA  LK  D++            + IPR + H    LA+ +P          +PTIDL G D  D       +E I  A+ + GFFQV+NHG+ +E+LE+M   ++ FHEQPP+++  +Y R+  +   Y+SN DL+ + AA+WRDT    +    PE +++PEICR   +E++  V
Sbjct:    9 SFDRASELKAFDETKTGVKGLVDSGISKIPRIFHHSSVELANPKPLPSDLLHLKTIPTIDLGGRDFQDAIKHKNAIEGIKEAAAKWGFFQVINHGVSLELLEKMKDGVRDFHEQPPEVRKDLYSRDFGRKFIYLSNFDLYTAAAANWRDTFYCYMAPDPPEPQDLPEICRDVMMEYSKQV 188          
BLAST of CN181488 vs. ExPASy Swiss-Prot
Match: ACCH3_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.971e-28
Identity = 63/179 (35.20%), Postives = 100/179 (55.87%), Query Frame = 1
Query:   70 YDRAKPLKRSDDSXXXXXXXXXXXXTAIPRFYIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL--RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPDIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHV 600
            +DRA  LK  D++            + +PR + HP   L+  +P          +PTIDL G D  D   R   +E+I  A+ + GFFQV+NHG+ +E+LE+M + ++ FHEQ  +++   Y R+ ++   Y+SN DLF S AA+WRDT    +    P+ +++PEICR   +E++  V
Sbjct:   10 FDRASELKAFDETKTGVKGLVDSGVSQVPRIFHHPTVKLSTPKPLPSDLLHLKTIPTIDLGGRDFQDAIKRNNAIEEIKEAAAKWGFFQVINHGVSLELLEKMKKGVRDFHEQSQEVRKEFYSRDFSRRFLYLSNFDLFSSPAANWRDTFSCTMAPDTPKPQDLPEICRDIMMEYSKQV 188          
BLAST of CN181488 vs. ExPASy Swiss-Prot
Match: ACCH1_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.618e-28
Identity = 69/186 (37.10%), Postives = 104/186 (55.91%), Query Frame = 1
Query:   46 ATIMSLESYDRAKPLKRSDDSXXXXXXXXXXXXTAIPRFYIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL-RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPDIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHV 600
            +++  + + DR+  LK  D++            T IP  +  PPATL   +P S +      +PTIDL G  +D + R ++VEKI  A+ + GFFQV+NHGI ++VLE+M+  I+ FHEQ  ++K   Y R+    + Y SN DLF S AA+WRDTL        P  E++P  C +  +E++  V
Sbjct:    3 SSLPQVAALDRSTLLKAFDETKTGVKGLIDAGITEIPSIFRAPPATLTSPKPPSSS---DFSIPTIDLKGGGTDSITRRSLVEKIGDAAEKWGFFQVINHGIPMDVLEKMIDGIREFHEQDTEVKKGFYSRDPASKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPATCGEMMIEYSKEV 185          
BLAST of CN181488 vs. ExPASy Swiss-Prot
Match: ACCH3_SOLLC (1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 9.556e-27
Identity = 67/184 (36.41%), Postives = 100/184 (54.35%), Query Frame = 1
Query:   64 ESYDRAKPLKRSDDSXXXXXXXXXXXXTAIPRFYIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDLR-PTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPDIKAPVYRRENTKGVSYISNIDLFHSK--AASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQ 606
            ESYD+   LK  DD+            T +P+ ++ PP      + ++K      V P IDL G+D D ++   IV+K+  AS + GFFQVVNHGI   VL+R ++  + F EQ  ++K   Y R+  K V Y SN+DL+ S   AASWRDT+   +    P L+E P  C +  ++++  VK+
Sbjct:    8 ESYDKMSELKAFDDTKAGVKGLVDSGITKVPQIFVLPP------KDRAKKCETHFVFPVIDLQGIDEDPIKHKEIVDKVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPCGESLIDFSKDVKK 185          
BLAST of CN181488 vs. ExPASy Swiss-Prot
Match: DV4H_CATRO (Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 7.572e-24
Identity = 64/185 (34.59%), Postives = 104/185 (56.22%), Query Frame = 1
Query:   58 SLESYDRAKPLKRSDDSXXXXXXXXXXXXTAIPRFYIHPPATLADLRPKSKTRPVSDV-VPTIDLSGVDSD-DLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPDIKAPVYRREN-TKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVK 603
            +L   +  + LK  D++            T IPR +I  P  L  +   S  R  SD+ +P I+L+G+ S+ ++R  IVEKI  AS + GFFQ+VNHGI  +V+++MV  ++ FHEQ   IK   Y R+   K   Y SN  L    A +WRDT++  +   +P+ +E P++CR   ++++++V+
Sbjct:   35 TLSEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDRI---SVCRGKSDIKIPVINLNGLSSNSEIRREIVEKIGEASEKYGFFQIVNHGIPQDVMDKMVDGVRKFHEQDDQIKRQYYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPDPQEFPDVCRDILMKYSNYVR 216          
The following BLAST results are available for this feature:
BLAST of CN181488 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
GSL_ARATH1.425e-3036.67Probable 2-oxoacid dependent dioxygenase OS=Arabid... [more]
ACCH2_ARATH1.742e-2836.111-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
ACCH3_ARATH2.971e-2835.201-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
ACCH1_ARATH6.618e-2837.101-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
ACCH3_SOLLC9.556e-2736.411-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
DV4H_CATRO7.572e-2434.59Deacetoxyvindoline 4-hydroxylase OS=Catharanthus r... [more]
back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A10_f Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181488 ID=CN181488|Name=CN181488|organism=Citrus sinensis|type=EST|length=649bp
ATTCTTTGTTTCACTCAAGATATCAAATATCAATTAACAAGAAGAGCTAC
AATCATGAGCCTAGAATCATACGACAGGGCCAAACCTTTAAAACGATCCG
ACGATTCCAAAGTCGGGGTCAAAGGTTTAGTTGACTTGGGCGTCACCGCC
ATCCCCCGCTTTTACATCCACCCACCCGCCACTCTTGCCGATCTCAGACC
CAAGTCAAAGACCCGGCCCGTCTCTGATGTAGTCCCCACCATCGATTTAT
CGGGCGTTGACTCGGACGATCTGCGGCCGACGATTGTGGAAAAGATAGCA
TGTGCCTCTCGGGAGCTGGGGTTCTTTCAGGTTGTGAATCACGGCATCGG
AGTTGAGGTCTTGGAGCGTATGGTTCGGGCCATTAAAGGGTTTCATGAAC
AGCCGCCGGATATCAAGGCGCCGGTGTATCGTAGGGAGAACACCAAAGGC
GTGTCTTACATTTCCAACATCGATTTGTTTCACTCTAAAGCTGCCAGCTG
GAGGGACACACTGCAGATAAGGCTAGGTCTGACGGAACCAGAGCTTGAAG
AAGTTCCTGAAATATGTAGGAAAGAGGCAGTCGAGTGGAACCACCATGTA
AAACAGCTCGGAGAGCTTTTGTTTGGGCTGCTGTGTGAAGGTTTGGGGT
back to top