CN181482

Overview
NameCN181482
Unique NameCN181482
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length741
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10309 contig Csv1_Contig10309:34..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: FHIT_DICDI (Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.580e-32
Identity = 69/145 (47.59%), Postives = 94/145 (64.83%), Query Frame = 1
Query:   73 FGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEENDGNKDVKEKQKLDLDIQMKNRTMEEMAQEADEYRSLLSK 507
            FGP+ I   ++F++T LS+ALVNL+P+LPGHVLVCP+R   R  DLT +E  DLWL+AQ + + +E +     + FAIQDG  AGQTV HVHIHI+PRK    E ND   +  EK++       + R+ EEM +E+ E R L  +
Sbjct:    6 FGPWLIRQSEIFFTTELSFALVNLKPVLPGHVLVCPKRIVPRVKDLTKEEFTDLWLSAQRISSVVEEHFNGDGITFAIQDGKNAGQTVEHVHIHIIPRKKFDFENNDQIYNEIEKER-------EPRSYEEMEKESSELRPLFEE 143          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: FHIT_BOVIN (Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.640e-31
Identity = 71/143 (49.65%), Postives = 91/143 (63.64%), Query Frame = 1
Query:   67 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEENDGNKDVKEK-QKLDLDIQMKNRTMEEMAQEADEYR 492
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF D++ +E  DL+  AQ VGT +E + + +SL F++QDGP+AGQTV HVH+HI+PRKA     ND   D  EK  + D D     R+ EEMA EA   R
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQAAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHRNDSIYDALEKHDREDKDSPALWRSEEEMAAEAAALR 145          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: FHIT_HUMAN (Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 2.360e-30
Identity = 69/142 (48.59%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   67 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEENDGNKDVKEKQKLDLDIQMKNRTMEEMAQEADEYR 492
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF DL  DE  DL+ T Q VGT +E +   +SL F++QDGP+AGQTV HVH+H++PRKA     ND   +  +K   + D     R+ EEMA EA   R
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKE-DFPASWRSEEEMAAEAAALR 143          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: FHIT_RAT (Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.998e-29
Identity = 67/144 (46.53%), Postives = 91/144 (63.19%), Query Frame = 1
Query:   67 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEENDGNKDVKEK-QKLDLDIQMKNRTMEEMAQEADEYRS 495
            + FG   I P  VF  T LS+ALVN +P++PGHVL+CP R   RF DL  DE  DL+   Q VGT +E + + +S+ F++QDGP+AGQTV HVH+HI+PRK+     ND   D  +K  + + D     R+ EEMA EA+  R+
Sbjct:    3 FKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKSGDFRRNDNIYDELQKHDREEEDSPAFWRSEEEMAAEAEVLRA 146          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: FHIT_MOUSE (Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=2 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 2.609e-29
Identity = 67/143 (46.85%), Postives = 90/143 (62.94%), Query Frame = 1
Query:   67 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEENDGNKDVKEK-QKLDLDIQMKNRTMEEMAQEADEYR 492
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF DL  DE  DL+   Q VGT +E + + +S+ F++QDGP+AGQTV HVH+H++PRKA     ND   D  +K  + + D     R+ +EMA EA+  R
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALR 145          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: NFT1_CAEEL (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.691e-28
Identity = 67/157 (42.68%), Postives = 93/157 (59.24%), Query Frame = 1
Query:   31 LFLSPKMSSIEQYAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEENDGNKDVKEKQKLDLDIQMKNRTMEEMAQEADEYRSLL 501
            L ++ K S      F  F I    +FYSTP S+  VNL+P+  GHVLV P+R   R  DLT  ET DL++ A+ V   LE +H  +S    +QDG  AGQTVPHVHIHI+PR+A    +N+  + +    K   + + K R+ E+MA+EA  YR+L+
Sbjct:  287 LHINEKSSETGGLKFARFNIPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAETADLFIVAKKVQAMLEKHHNVTSTTICVQDGKDAGQTVPHVHIHILPRRAGDFGDNEIYQKLASHDK---EPERKPRSNEQMAEEAVVYRNLM 440          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: APH1_SCHPO (Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe GN=aph1 PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 3.300e-24
Identity = 70/176 (39.77%), Postives = 89/176 (50.57%), Query Frame = 1
Query:   61 EQYAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEEND-------------------GNK--------DVKEKQKLDLDIQMKNRTMEEMAQEADEYRSLLSK 507
            +Q  F  F +   QVFY T LS A VNL+P+LPGHVLV P+R   R  DLT  E  DL+ + + V   +E    AS+    IQDG  AGQTVPHVH+HI+PRK A   END                   GN+            +Q +  D   K RT+EEM +EA   +   S+
Sbjct:    3 KQLYFSKFPVGS-QVFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLFTSVRKVQQVIEKVFSASASNIGIQDGVDAGQTVPHVHVHIIPRKKADFSENDLVYSELEKNEGNLASLYLTGNERYAGDERPPTSMRQAIPKDEDRKPRTLEEMEKEAQWLKGYFSE 177          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: HNT2_YEAST (Hit family protein 2 OS=Saccharomyces cerevisiae GN=HNT2 PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 8.412e-20
Identity = 46/90 (51.11%), Postives = 64/90 (71.11%), Query Frame = 1
Query:  100 QVFYSTPLSYALVNLRPLLPGHVLVCPRRDAV-RFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPR 366
            QVFY +  +YALVNL+P++PGHVL+ P R  V    DLT  E++D + T Q +   ++  +KA S+  AIQDGP+AGQ+VPH+H HI+PR
Sbjct:   15 QVFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPESQDYFKTLQLIHRFIKWQYKADSINVAIQDGPEAGQSVPHLHTHIIPR 104          
BLAST of CN181482 vs. ExPASy Swiss-Prot
Match: NFT1_DROME (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster GN=NitFhit PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.215e-18
Identity = 56/142 (39.44%), Postives = 76/142 (53.52%), Query Frame = 1
Query:   88 IDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASSEENDGNKDVKEKQKLDLDIQMK-NRTMEEMAQEADEYRSLLSKI 510
            +D R +FY +   +A  NLR ++ GHVLV  +R   R   L   E  D++ T   V   LE  ++ +S    +QDG QAGQTVPHVH HI+PR+      ND     +   KLD   + K  RT+EE  +EA  YR  L+ I
Sbjct:  323 VDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQAGQTVPHVHFHIMPRRLGDFGHND-----QIYVKLDERAEEKPPRTIEERIEEAQIYRKFLTDI 459          
The following BLAST results are available for this feature:
BLAST of CN181482 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
FHIT_DICDI9.580e-3247.59Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium d... [more]
FHIT_BOVIN3.640e-3149.65Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=F... [more]
FHIT_HUMAN2.360e-3048.59Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN... [more]
FHIT_RAT1.998e-2946.53Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegic... [more]
FHIT_MOUSE2.609e-2946.85Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN... [more]
NFT1_CAEEL1.691e-2842.68Nitrilase and fragile histidine triad fusion prote... [more]
APH1_SCHPO3.300e-2439.77Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] ... [more]
HNT2_YEAST8.412e-2051.11Hit family protein 2 OS=Saccharomyces cerevisiae G... [more]
NFT1_DROME1.215e-1839.44Nitrilase and fragile histidine triad fusion prote... [more]
back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A06_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181482 ID=CN181482|Name=CN181482|organism=Citrus sinensis|type=EST|length=741bp
CCCCGGGCTGCAGGTCGATCACCTCCTCCACTGTTTCTGTCGCCAAAGAT
GTCATCCATCGAGCAATATGCGTTCGGCCCTTTTAAGATAGATCCTAGGC
AAGTGTTCTATTCAACCCCTCTATCCTACGCCTTGGTCAACTTGCGCCCT
CTGCTTCCTGGTCATGTGCTTGTCTGCCCAAGGCGTGACGCGGTTCGCTT
TGGTGATCTTACTGCTGATGAGACCCGTGATTTATGGCTCACGGCCCAGA
CAGTTGGCACACAGCTCGAAAGCTACCACAAGGCTTCATCACTAGCATTT
GCCATTCAAGATGGACCTCAAGCTGGACAGACAGTGCCCCATGTTCACAT
CCATATTGTCCCACGCAAAGCTGCCAGCTCTGAGGAAAATGATGGGAATA
AAGATGTGAAGGAGAAGCAGAAGCTTGATTTAGATATTCAAATGAAGAAC
AGGACCATGGAGGAGATGGCTCAAGAGGCTGATGAGTACAGGTCGCTTTT
GTCAAAAATTTAACACTGCCTTTCGCTAAGCTTTTCTCAAGCTTTCATCA
AAGCTGCCTCCAATGCGTTTGAGATTTAAGAAACTGCCCTTCAATAATAC
TTCATGGAAGTTTATAAACATTTATAATACTTACGCTAAGCATTGGGGCT
TTCATAGAATTATTATACATCATACCTATGCAGAATAATCCTTCACTCGT
CCTCTTGTTGCGCTGGAAATCCTGAAATTCTAAGTTTATTA
back to top