CN181480

Overview
NameCN181480
Unique NameCN181480
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length702
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN181480_ssr230 microsatellite CN181480_ssr230:230..244. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9675 contig Csv1_Contig9675:28..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181480 vs. ExPASy Swiss-Prot
Match: ELI_PEA (Early light-induced protein, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 9.945e-52
Identity = 113/177 (63.84%), Postives = 132/177 (74.58%), Query Frame = 1
Query:  139 RSGANQLSSVK--YLPSLRRNVNLSVRCTAXXXXXXXXXXXX-PTIPKAE---PQPP--KKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 645
            RS  NQ +++   Y+P+LRRNV+L VR  A             PT P A    PQP   + P+MST FS++ AFSGPAPERINGRLAMIGFVAA+GVEI+KGQ +  QLS GGVAWFLGTSVLL++ASL+P F+GVSVESKS   M+SDAE WNGR AMLGLVALAFTEFVKG +LV
Sbjct:   20 RSRVNQFTNIPSVYIPTLRRNVSLKVRSMAEGEPKEQSKVAVDPTTPTASTPTPQPAYTRPPKMSTKFSDLMAFSGPAPERINGRLAMIGFVAAMGVEIAKGQGLSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAMLGLVALAFTEFVKGTSLV 196          
BLAST of CN181480 vs. ExPASy Swiss-Prot
Match: DS22_CRAPL (Desiccation stress protein DSP-22, chloroplastic OS=Craterostigma plantagineum GN=DSP-22 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.821e-37
Identity = 91/198 (45.96%), Postives = 126/198 (63.64%), Query Frame = 1
Query:   70 MAASLATQSMLASPVAARVTGIRRSGANQLSSVKY---LPSLRRNVNLSVRCTAXXXXXXXXXXXXP--TIPKAEPQPPKKPRMSTGFS-EVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 645
            MA+S    ++ A     + T I R G N L   K    LP +RRN   +VR                  T        P +  ++T  + ++F+F G APERINGR AMIGFVAA+GVE++ G+DVF+Q+ +GGV WFL TS +L +A+L+P+++G+S E+K++GF  SDAE+WNGRFAM+GLVALAFTE+VKGG L+
Sbjct:    1 MASSTCYATIPAMSCRGQST-ITRFGPNNLFLGKQSYELPLMRRNAKFTVRSMREDNEKEEQQQQKQQQTHDGGPDLTPNRTEVTTKRTVDLFSFDGLAPERINGRSAMIGFVAAVGVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGFWNSDAEIWNGRFAMIGLVALAFTEYVKGGPLI 197          
BLAST of CN181480 vs. ExPASy Swiss-Prot
Match: ELI5_HORVU (High molecular mass early light-inducible protein HV58, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.916e-33
Identity = 75/131 (57.25%), Postives = 93/131 (70.99%), Query Frame = 1
Query:  259 PTIPKAEPQPPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLS--DGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 645
            PT   A P+P  K + +    +  AFSGPAPERINGRLAM+GFVAAL VE ++G  +  Q+     G+AWFL T+ + +VASL+PL +G SVESKS G  ++DAELWNGRFAMLGLVALA TEF+ G   V
Sbjct:  100 PTTIPAAPKPVTK-KANPSVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVFSVASLLPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFITGAPFV 229          
BLAST of CN181480 vs. ExPASy Swiss-Prot
Match: ELI9_HORVU (Low molecular mass early light-inducible protein HV90, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.303e-32
Identity = 86/189 (45.50%), Postives = 111/189 (58.73%), Query Frame = 1
Query:   82 LATQSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAXXXXXXXXXXXXPTIPKAEPQPPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDG-GVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 645
            +AT   ++S   A V  + RS A+   + + LP+L R   L VR               P+ P     PP KP+ ST   +  AFSGPAPERINGRLAM+GFV AL VE  +G  + +QL  G G AWF  T  +L++ASLVPL +G S E ++   M ++AELWNGRFAMLGLVALA TE + G   +
Sbjct:    1 MATMMSMSSFAGAAV--VPRSSASSFGA-RSLPALGRRA-LVVRAQTEG----------PSAP-----PPNKPKASTSIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFI 170          
BLAST of CN181480 vs. ExPASy Swiss-Prot
Match: ELI6_HORVU (Low molecular mass early light-inducible protein HV60, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.131e-32
Identity = 68/117 (58.12%), Postives = 84/117 (71.79%), Query Frame = 1
Query:  286 PPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDG-GVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKG 633
            PP KP+ ST   +  AFSGPAPERINGRLAM+GFV AL VE  +G  + +QL  G G AWF  T  +L++ASLVPL +G S E ++   M ++AELWNGRFAM+GLVALA TE + G
Sbjct:   45 PPNKPKASTSIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAMLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMIGLVALAATEIITG 161          
BLAST of CN181480 vs. ExPASy Swiss-Prot
Match: CBR_DUNBA (Carotene biosynthesis-related protein CBR, chloroplastic OS=Dunaliella bardawil GN=CBR PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.893e-18
Identity = 61/128 (47.66%), Postives = 73/128 (57.03%), Query Frame = 1
Query:  262 TIPKAEPQPPKKPRMSTG--FSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSD--GFMTSDAELWNGRFAMLGLVALAFTEFVKG 633
            T P + P PP  P        +EV  FSG APE INGRLAM+GFVAALG E+S G+ V  QL D      L T VL + ASL+P F       K D  G  T DAE+ NGRFAM+G  A+   E ++G
Sbjct:   47 TPPPSSPSPPPPPPTPAAPTVTEVMGFSG-APEIINGRLAMLGFVAALGAELSTGESVLTQLGDQPTLIAL-TFVLFSAASLIPAF----ARRKGDAMGPFTPDAEMTNGRFAMIGFAAMLVYEGIQG 168          
The following BLAST results are available for this feature:
BLAST of CN181480 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ELI_PEA9.945e-5263.84Early light-induced protein, chloroplastic OS=Pisu... [more]
DS22_CRAPL1.821e-3745.96Desiccation stress protein DSP-22, chloroplastic O... [more]
ELI5_HORVU7.916e-3357.25High molecular mass early light-inducible protein ... [more]
ELI9_HORVU2.303e-3245.50Low molecular mass early light-inducible protein H... [more]
ELI6_HORVU5.131e-3258.12Low molecular mass early light-inducible protein H... [more]
CBR_DUNBA1.893e-1847.66Carotene biosynthesis-related protein CBR, chlorop... [more]
back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A05_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181480 ID=CN181480|Name=CN181480|organism=Citrus sinensis|type=EST|length=702bp
GAGGCGCCGACCTGAAGCACCCAATTCCCGAATTATACTTTGTTCTGTTT
TCTACTTCATAAATTAAAAATGGCCGCATCACTTGCTACTCAATCTATGC
TGGCAAGTCCTGTAGCAGCTCGTGTGACTGGTATCAGGAGATCCGGGGCA
AACCAACTTTCCTCCGTCAAGTACTTGCCTAGTCTGCGTAGAAATGTCAA
CTTATCCGTGCGCTGCACGGCAGAGGATGAGCAGCAGCAGCAGCAGAAAG
ATGATCAACCAACCATACCGAAAGCTGAGCCTCAGCCACCAAAGAAGCCG
CGGATGAGCACGGGGTTCTCTGAGGTGTTCGCGTTCAGCGGGCCGGCACC
GGAGAGGATAAACGGGAGGCTTGCGATGATTGGGTTCGTGGCTGCATTGG
GGGTGGAGATATCCAAGGGTCAGGATGTGTTTGCCCAGTTATCAGACGGT
GGGGTTGCCTGGTTCTTGGGGACCAGTGTTTTGCTCACGGTTGCGTCCCT
GGTTCCTTTGTTTAAAGGTGTCAGCGTGGAGTCTAAATCGGATGGGTTCA
TGACTTCGGATGCTGAGTTGTGGAATGGGAGGTTTGCTATGCTGGGCCTT
GTTGCTTTGGCTTTCACCGAGTTTGTTAAGGGTGGCACCCTTGTTTAAGC
TTAATTTTGTTTAGATCTGTAGATCTGTATTTTTTTTAACTAATTAATGT
AT
back to top